Conserved Protein Domain Family
HpaC

?
TIGR02296: HpaC 
4-hydroxyphenylacetate 3-monooxygenase, reductase component
This model identifies the reductase component (HpaC) of 4-hydroxyphenylacetate 3-monooxygenase. This enzyme catalyzes the first step (hydroxylation at the 3-position) in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate. 4-hydroxyphenylacetate arises from the degradation of tyrosine. These reductases catalyze the reduction of free flavins by NADPH. The flavin is then utilized by the large subunit of the monooxygenase.
Statistics
?
PSSM-Id: 131349
View PSSM: TIGR02296
Aligned: 5 rows
Threshold Bit Score: 269.708
Threshold Setting Gi: 37198503
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAK03606       9 FRNSMAKLAAGVNIITTNGIAGKCGITATAVCSVTDTPPTIMVCINKNSEMNPVFQTNKRLCVNVLSAEQLELAQHFAGF 88  Pasteurella mul...
Q57501        10 FRDAMASLSAAVNIITTEGDAGQCGITATAVCSVTDTPPSLMVCINANSAMNPVFQGNGKLCVNVLNHEQELMARHFAGM 89  Escherichia coli
BAC94338       7 FRDAMSKLAAAVNIVTTGGEAGTVGITATAVCSVSDSPATVLVCVNRNSASNAIFKQNGNMCINVCASEHQEMSMHFAGM 86  Vibrio vulnific...
AAP95866      16 FRDAMAHLSAAVSIVTTNGIAGKIGLTVSSVCSVTDTPPTLLFCINKNSGVHDIIQANGKVCINVLNHQQEEMAKHFASM 95  Haemophilus duc...
WP_002224077  12 FRDAMASCAAGVHVITTDGAAGRYGITMTAVAPVTDEPPTVMLCINRSARIIPILSENGSLCINTLADEHQDVAEHFAGL 91  Neisseria menin...
AAK03606      89 MGSCMDERFEWAVWHEKqdPVAPPSLKNALANLTGTIVDIRDIGTHSMFLVELEEIQVNEeQEHALVYFSRQFHTVG 165 Pasteurella multoc...
Q57501        90 TGMAMEERFSLSCWQKG--PLAQPVLKGSLASLEGEIRDVQAIGTHLVYLVEIKNIILSA-EGHGLIYFKRRFHPVM 163 Escherichia coli
BAC94338      87 TGLAMEERFALEGWKNN--ADQVPVLHGALATLEGKIASSQEVGTHTVFFVELHTIHSNN--KDGLIYFDREFKNVD 159 Vibrio vulnificus ...
AAP95866      96 LPSTMEERFSWDIWDEG--IDGLPILRDAISALQGDIIDTHSVGTHTIFMVQLKHIEVKP--SNSLVYFGRQFKVIT 168 Haemophilus ducrey...
WP_002224077  92 TGLSPEERFAYHIWHRG--KTGQLEIEGALAHLHGHIVGKHEIGTHFVFYVRLDEIKNCGcKRPALLYFRRQFRFLD 166 Neisseria meningit...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap