Conserved Protein Domain Family
TAS_TIGR02293

?
TIGR02293: TAS_TIGR02293 
putative toxin-antitoxin system antitoxin component, TIGR02293 family
Proteins in this family are found almost exclusively in the Proteobacteria, but also in Gloeobacter violaceus PCC 7421, a cyanobacterium. This family was proposed by Makarova, et al. (2009) to be the antitoxin component of a new class of type 2 toxin-antitoxin system, or addiction module. [Cellular processes, Other]
Statistics
?
PSSM-Id: 131346
View PSSM: TIGR02293
Aligned: 5 rows
Threshold Bit Score: 172.255
Threshold Setting Gi: 14027898
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAG22120      15 LWREIGLPAsRGTVLVDSIKMGFSVDVIDSIH-LWASIPKAE-ILRATGIPSRSLTRRRTHDg-RFTPEESERIARFVRV 91  Yersinia entero...
AAO54569      18 FWQHLGIPA-RGTRLYTALHSGLPYEVFERLA-HYTDLNRST-LAEHLGIAPATLQRRLKVR--RFNAEESDRLFRLAAV 92  Pseudomonas syr...
CAE33390      33 VDSFADLVDsPLIAMAHGVQRGLSPRLLDDAA-DYLQVPKSE-IMAITEVKAASLSRWMRDGq-ALPLGESDRLARVARV 109 Bordetella bron...
BAB54490      16 GLPVKEVAArSPFGLISRIEDGLPIGALERVA-HLLAPGDAQ--FKYRLIPKATYERRKMAH--RLSSDEGTRLARVARV 90  Mesorhizobium l...
WP_010976218  26 GSRVLAHHLtNALDAHELLLRGLPASALDHLVgNLVFIGKTEsLEKAVGMSLRTWQRRKETPnkPLSQEQSGRAWKFAEI 105 Sinorhizobium m...
AAG22120      92 MDAAVDLFGGDkGKAITWMSTPIKGLGHRSPDS-LLETETGALEVCDLIGRLEHGVFS 148 Yersinia enterocolitica
AAO54569      93 YKAALDLFEDDtEATRLWLANPVYGLGNRRPLE-MLATSAEAQAVLDLIGRLEHGVVA 149 Pseudomonas syringae pv. tomato str. ...
CAE33390     110 TKVARQVLGGD-AEAVQWLNTPVPALGNVKPLS-LLTSDASSRIVEDTLARAAAGVYA 165 Bordetella bronchiseptica RB50
BAB54490      91 WGLAVDVWQNE-EEARDFLFRPHPMIEDKRPIDvVILSEFGAEIAVDILGSLKYGSAA 147 Mesorhizobium loti MAFF303099
WP_010976218 106 LVKATDIFGSQ-AEAEQWLERPAVGLDQRRPID-LLGTPPGVELVEDHLDRLEYGIYA 161 Sinorhizobium meliloti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap