Conserved Protein Domain Family
PaaN_2

?
TIGR02288: PaaN_2 
phenylacetic acid degradation protein paaN
This enzyme is proposed to act in the ring-opening step of phenylacetic acid degradation which follows ligation of the acid with coenzyme A (by PaaF) and hydroxylation by a multicomponent non-heme iron hydroxylase complex (PaaGHIJK). Gene symbols have been standardized in. This enzyme is related to aldehyde dehydrogenases and has a domain which is a member of the pfam00171 family. This family includes sequences from Burkholderia, Bordetella, Streptomyces. Other PaaN enzymes are represented by a separate model, TIGR02278.
Statistics
?
PSSM-Id: 131341
View PSSM: TIGR02288
Aligned: 4 rows
Threshold Bit Score: 990.537
Threshold Setting Gi: 33576842
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAE33922       2 SQDFFERHQPMLQKALEAAAQRGYWSPFPESpsPRNYGETAAQD---GQAAFEALRGKPFALDLPQASGAVGGEVSPFGF 78  Bordetella bron...
CAD76913       9 ALELFDHHRDTLERAVQAIAERGYWSPFPES--LRQYPEEAVMG---AQAEFEALLGRHFALAGPQPIGRSGAERSPYGF 83  Pseudomonas sp. Y2
AAG28964      10 PAQLFDKHHATLEAAVQAIHARGYWTPYPEMpsPKVYGETAQDD---GRRAVEACFGQDFDLGQPGRSGWMASERSPYGV 86  Azoarcus evansii
WP_011029260   7 AHQLIARHRPTLDLALETIRTRAYWSPHPEH--PKAYGENGSLDtaaGKAAFDALHGTRLDLGQPGTDGWVGGEVSPYGV 84  Streptomyces
CAE33922      79 ELGITYPQVAPEALVAASSKALEQWRRAGPRAWVGVSLEILQRLNRRSFEMAHAVQHTTGQAFMMAFQAGGPHAQDRGVE 158 Bordetella bron...
CAD76913      84 ELGVTYDQYDTDELLERQQKALPGWRDAGARARVGACLEILQRLNALSPALAHAVMHTTGQAFMMAFQAGGAHAQDRGLE 163 Pseudomonas sp. Y2
AAG28964      87 ELGVRYPVCDGQALIDAAHAAMPGWQRIGAQGRAGVCLEILERLNKRSFEIAHAVMLTTGQGWMMAFQAGGPHAQDRGLE 166 Azoarcus evansii
WP_011029260  85 ELGVEYPHADLDVLLPAMRAGQKAWRDAGAELRAMVCLEILQRIAARTMEFAQAVMHTSGQAFMMAFQAGGPHAQDRGME 164 Streptomyces
CAE33922     159 AVTYAWQEMSRIPGVALWEKPQGKHDPIKMEKRFTVVPRGIALVIGCSTFPTWNGYPGLFASLATGNTVIVKPHPGAILP 238 Bordetella bron...
CAD76913     164 ALAYAWRAMAEVPETACWIKPQGKQDPLLLDKRWHIVPRGLSLVIACSTFPTWNTYPGLFASLATGNPVLVKAHPGAILP 243 Pseudomonas sp. Y2
AAG28964     167 AVAYAYREMKFIPHETVWEKPQGKNPPLKMKKHFEIVGRGVALVIGCGTFPTWNTYPGLFAALATGNPVIVKPHQNAILP 246 Azoarcus evansii
WP_011029260 165 AVAYAYVEQSRTPETAEWTKPQGKRDPLALTKRFTPVPRGIGLVVGCNTFPTWNGYPGLFASLATGNAVLVKPHPRAVLP 244 Streptomyces
CAE33922     239 LALTVQVAREVLGEAGFDPDVVLLAAHPAGDDTAQRLALDPAVRIVDFTGSSANGNWLEQNARQALVYTEKAGVNQVLID 318 Bordetella bron...
CAD76913     244 VAMSVKVAQEVLGELGFDPALVSLVVDTPEAPVAQRLALDPRVRLVDFTGSNAFGEWLEQHARQAQVFTEKAGINTLIID 323 Pseudomonas sp. Y2
AAG28964     247 AAITVRIAREVLAEAGLDPNLVTLAAFD-KHEATQALATHPAVKSIDFTGGNAFGQWLISNAKQAQVYAELAGVNNVVIE 325 Azoarcus evansii
WP_011029260 245 LALTVQVARHVLTEAGFDPNLVALAAERPGEGIAKTLATRPEIRIIDYTGSTAFGDWLEANARQAQVYTEKAGVNTVIVE 324 Streptomyces
CAE33922     319 STDDLKGVARNLAFSLALYSGQMCTAPQNIYVPRDGIQTAEGRVGFDEVAAALGAALDKLAGDPAKAVELTGAVQNDATV 398 Bordetella bron...
CAD76913     324 STHDLKAVAKNLAFSLSLYSGQMCTTTQAIYVPRDGIRNGDEQLSFDQVADTLASAINGLLSDNDRACAVLGAIQSEATA 403 Pseudomonas sp. Y2
AAG28964     326 STDQYKAMLRNLAFTLCLYSGQMCTTTQAILVPADGIDTDQGRKSYDEVCADLATSIDKFLADPAVATAVLGAIQSPDTL 405 Azoarcus evansii
WP_011029260 325 STDDYQGMLANLAFSLSLYSGQMCTTPQNLLIPRDGIRTDQGAKSYDEVTADLARAVDGLLGDDARANALLGAIVNPDVK 404 Streptomyces
CAE33922     399 ARIGKARQLGlPVLADSKALAHPQFEQARVHTPLLLRADAG---N-DALGQEWFGPIAFVVATDSTAHSIELAGASVRQH 474 Bordetella bron...
CAD76913     404 ARIADCRALG-EVLLDSEVREHPQFPGARVRTPLLLKVDAS---DrAAYAQERFGPIAFVIATDDSAHSLRVAREVIAEK 479 Pseudomonas sp. Y2
AAG28964     406 ARIAEAPAHG-RVVRASTKIEHAEFPGAEVRSPLLLACDAA---DeKAYMEERFGPIAFVVKVADGAAAVTLSERIVREH 481 Azoarcus evansii
WP_011029260 405 ARLEAAAGLG-EVALASREVTNPEFPDAVVRTPVIVKLDGAkpeDeAAYTSECFGPVSFAVAVDSADHAVELLRRSVREK 483 Streptomyces
CAE33922     475 GALSLSAYTTDEAVASRVQDMAEHSGVSLSLNLTGGVFVNQTAAFSDFHGTGANPAANAALSDSAFVANRFRVVQTRRHV 554 Bordetella bron...
CAD76913     480 GAMTLGVYSTDAAFLYQAESLARDVAVALSVNFDGGVFVNQSAAFSDFHATGGNPAANASITDGAFVSRRFVTVQSRRPA 559 Pseudomonas sp. Y2
AAG28964     482 GALTVGLYTTKPEVVDAMTEATWRAGVALSINLTGGVFVNQSAGFSDYHGVGMNPAANASLSDSAFVANRFRVVQRRHHV 561 Azoarcus evansii
WP_011029260 484 GAMTVGAYTTDPEVEEAVQEVCLDEAAQLSLNLTGGVYVNQTAAFSDFHGSGGNPAANAALCDGAFVANRFRVVEVRRPA 563 Streptomyces
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap