Conserved Protein Domain Family

TIGR02287: PaaY 
phenylacetic acid degradation protein PaaY
Members of this family are located next to other genes organized into apparent operons for phenylacetic acid degradation. PaaY is located near the end of these gene clusters and often next to PaaX, a transcriptional regulator. [Energy metabolism, Other]
PSSM-Id: 131340
Aligned: 3 rows
Threshold Bit Score: 357.655
Threshold Setting Gi: 10635040
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
P77181   163 VTRCKQTLHQVEPLREIEPGRKRLVfDENLRPK 195 Escherichia coli K-12
AAN68892 163 AQRCMNSMVECPPLAEAEPGRPRME-DTGVRPK 194 Pseudomonas putida KT2440
AAN68892 163 AQRCMNSMVECPPLAEAEPGRPRME-DTGVRPK 194 Pseudomonas putida KT2440
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap