Conserved Protein Domain Family
PaaY

?
TIGR02287: PaaY 
phenylacetic acid degradation protein PaaY
Members of this family are located next to other genes organized into apparent operons for phenylacetic acid degradation. PaaY is located near the end of these gene clusters and often next to PaaX, a transcriptional regulator. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131340
View PSSM: TIGR02287
Aligned: 3 rows
Threshold Bit Score: 357.655
Threshold Setting Gi: 10635040
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P77181     3 IYQIDGLTPVVPEESFVHPTAVLIGDVILGKGVYVGPNASLRGDFGRIVVKDGANIQDNCVMHGFPEQDTVVGEDGHIGH 82  Escherichia coli K-12
AAN68892   3 CYRLDGLTPVVHPTAYVHPSAVLIGDVIVGPRCYIGPLASLRGDFGRIVLEEGANLQDTCVMHGFPGGDTVVERNGHVGH 82  Pseudomonas putida ...
CAC10600   3 CYEIDGLRPVVHPSAYVHPDAVLVGDVHIGARCYVAPLASLRGDFGPIILREGANVQDCCVMHGFPGIDTLVEENGHVGH 82  Azoarcus evansii
P77181    83 SAILHGCIIRRNALVGMNAVVMDGAVIGENSIVGASAFVKAKAEMPANYLIVGSPAKAIRELSEQELAWKKQGTHEYQVL 162 Escherichia coli K-12
AAN68892  83 GAVLHGCRVGEDSLIGMNAVVMDGAHVAPRCIVAATAFVKAGFECAAQSLVMGSPAQVKRPLSEQELAWKQRGTAEYQHL 162 Pseudomonas putida ...
CAC10600  83 GAILHSCHVGRNALVGMNAVVMDRAVIGESSIVAACSFVKAGMEIPPQVLVAGVPAKVVRTLTRQEMDWKVEGTRCYHDL 162 Azoarcus evansii
P77181   163 VTRCKQTLHQVEPLREIEPGRKRLVfDENLRPK 195 Escherichia coli K-12
AAN68892 163 AQRCMNSMVECPPLAEAEPGRPRME-DTGVRPK 194 Pseudomonas putida KT2440
CAC10600 163 AARSLTTLKPCEPLTEAEADRPAMV-LPEVVPL 194 Azoarcus evansii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap