1PSU,1J1Y


Conserved Protein Domain Family
PaaD

?
TIGR02286: PaaD 
Click on image for an interactive view with Cn3D
phenylacetic acid degradation protein PaaD
This member of the domain family TIGR00369 (which is, in turn, a member of the pfam03061 thioesterase superfamily) is nearly always found adjacent to other genes of the phenylacetic acid degradation pathway. Its function is currently unknown, but a role as a thioesterase is not inconsistent with the proposed overall pathway. Sequences scoring between trusted and noise include those from archaea and other species not known to catabolize phenylacetic acid and which are not adjacent to other genes potentially involved with such a pathway.
Statistics
?
PSSM-Id: 131339
View PSSM: TIGR02286
Aligned: 9 rows
Threshold Bit Score: 146.026
Threshold Setting Gi: 23397012
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1PSU_A    19 AKALGIDIISXDEGFAVVTXTVTAQXLNGHQSCHGGQLFSLADTAFAYACNSQGLAAVASACTIDFLRPGFAGDTLTATA 98  Escherichia coli
AAN68888  21 TQGLGISLLDAGPGRASLRMAVRADMIQGHGTCHGGFLFALADSAFAFACNSYDQATVALGCTIDYLAPALRDDVLTAHA 100 Pseudomonas putida ...
CAE27165  32 SKALGMEIVEIGAGSATLAMTVTTDMVNGHGIAHGGFIFTLADSAFAYACNSYNDSTVAAQGAITFIRPGKLGARLVAAA 111 Rhodopseudomonas pa...
P76084    19 AKALGIDIISMDEGFAVVTMTVTAQMLNGHQSCHGGQLFSLADTAFAYACNSQGLAAVASACTIDFLRPGFAGDTLTATA 98  Escherichia coli K-12
AAS80949   6 MEALGLKVLHLAPGEAAVAGEVRADHLNLHGTAHGGFLYALADSAFALASNTRGP-AVALSCRMDYFRPLGAGARVEARA 84  Thermus thermophilu...
Q9RS06    29 AEVLGMTILDASPDLTRVALTVTEAGLNMHGTAHGGLIFSLADEAFAVISNLDAQ-AVAAETHMSFFRAAREGERLVAVA 107 Deinococcus radiodu...
BAC17476  34 SKMLGVVITELSPEQARGHFTIREDMCNGHGTAQGGILFTFADAVFAGVCNAAGDVAVAAQVGIHYLSPARVGEVVEAEA 113 Corynebacterium eff...
AAG28967  33 LHANGIRFEAIGPGYAKVTMTVREDMLNGFDICHGGFITLLADTAFAYACNSGNEQTVASGISLDFMAPGRPGEVLCAEA 112 Azoarcus evansii
1J1Y_A     6 MEALGLKVLHLAPGEAVVAGEVRADHLNLHGTAHGGFLYALADSAFALASNTRGP-AVALSCRMDYFRPLGAGARVEARA 84  Thermus thermophilu...
1PSU_A    99 QVRHQGKQTGVYDIEIVN-QQQKTVALFRGKSHRI 132 Escherichia coli
AAN68888 101 SEVSRKGRTGLYDVRIDN-QRGELVAMFHGKSYKV 134 Pseudomonas putida KT2440
CAE27165 112 REVSRSGRSGIYDVRVT--SGSTVIAEFRGHSRSI 144 Rhodopseudomonas palustris CGA009
P76084    99 QVRHQGKQTGVYDIEIVN-QQQKTVALFRGKSHRI 132 Escherichia coli K-12
AAS80949  85 VEVNLSRRTATYRVEVVS--EGKLVALFTGTVFRL 117 Thermus thermophilus HB27
Q9RS06   108 TPERVGRTLATYRIEVRRgEEGEVLALFLGTVSRR 142 Deinococcus radiodurans R1
BAC17476 114 VCRQNWGRNGITDVTLR--VGDRIVAEFRGTSRVV 146 Corynebacterium efficiens YS-314
AAG28967 113 KEVFAAGRTGVYDISVTN-PKGELIAVMRGKSYRL 146 Azoarcus evansii
1J1Y_A    85 VEVNLSRRTATYRVEVVS--EGKLVALFTGTVFRL 117 Thermus thermophilus HB8
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap