Conserved Protein Domain Family

TIGR02286: PaaD 
Click on image for an interactive view with Cn3D
phenylacetic acid degradation protein PaaD
This member of the domain family TIGR00369 (which is, in turn, a member of the pfam03061 thioesterase superfamily) is nearly always found adjacent to other genes of the phenylacetic acid degradation pathway. Its function is currently unknown, but a role as a thioesterase is not inconsistent with the proposed overall pathway. Sequences scoring between trusted and noise include those from archaea and other species not known to catabolize phenylacetic acid and which are not adjacent to other genes potentially involved with such a pathway.
PSSM-Id: 131339
Aligned: 9 rows
Threshold Bit Score: 146.026
Threshold Setting Gi: 23397012
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
CAE27165 112 REVSRSGRSGIYDVRVT--SGSTVIAEFRGHSRSI 144 Rhodopseudomonas palustris CGA009
P76084    99 QVRHQGKQTGVYDIEIVN-QQQKTVALFRGKSHRI 132 Escherichia coli K-12
AAS80949  85 VEVNLSRRTATYRVEVVS--EGKLVALFTGTVFRL 117 Thermus thermophilus HB27
Q9RS06   108 TPERVGRTLATYRIEVRRgEEGEVLALFLGTVSRR 142 Deinococcus radiodurans R1
BAC17476 114 VCRQNWGRNGITDVTLR--VGDRIVAEFRGTSRVV 146 Corynebacterium efficiens YS-314
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap