Conserved Protein Domain Family
TIGR02285

?
TIGR02285: TIGR02285 
conserved hypothetical protein
Members of this family are found in several Proteobacteria, including Pseudomonas putida KT2440, Bdellovibrio bacteriovorus HD100 (three members), Aeromonas hydrophila, and Chromobacterium violaceum ATCC 12472. The function is unknown. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 131338
View PSSM: TIGR02285
Aligned: 5 rows
Threshold Bit Score: 356.405
Threshold Setting Gi: 34103772
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAN67096  12 LLCGLLPALLLQPANAK-EHLFWLVRDLPPFTIFDGP------EEGRGVIDQLLPLLIRQMPEYEHSIVRVNRARSLQML 84  Pseudomonas putida ...
AAQ95751   4 ILLILISFIISVDVTAK-ETIHWAQYDIPPFYIKDGS------YSGRGVVDVTDAMIRAELPQYNHVIIWANIARIKQMM 76  Aeromonas hydrophila
CAE79207   5 TVLFFLAVNMFCPLAWA-EDITWIRWDDPPIFIFSGP------FKGRGLLDNVESELRRKLPQYTHKTIEGTVPRVLKEA 77  Bdellovibrio bacter...
AAQ60133  14 AGFALLAFAAGASLAAEpYQITWVLSDWAPNFIIRDG------KPTTGQNDVYLKLIIARWPEAEHRFMVMSTARSTLEL 87  Chromobacterium vio...
CAE78991  14 GMWLSPQIAGAIEPPPQkPAIQWIVNDFPPFLVLSGEgmmvdiSKAKGPFASIYQEIERALPAYSHRFVRVSFSRAEKLF 93  Bdellovibrio bacter...
AAN67096  85 qDRDTFTCDpTLLWTPERAKYVHFS--VPALGVLSGGLVLRKENQALVAPYLDGhQVDLHGLLSKAPLKLGIVAERSYGT 162 Pseudomonas putida ...
AAQ95751  77 qQGKKVVCG-NMLKTPEREKYQTFStfHKTLSTAPHVIIPSSELNTYKQYIIDGdGVDLLRLIQSKDKLGYFIASRSYGS 155 Aeromonas hydrophila
CAE79207  78 -EAKAPVCNaGWLDTPEWSKLFYFS--RPVFVIPANGILLPKSRLVEVRNLAP---YSLQKFLDDK-KDWKLGVGRLYGV 150 Bdellovibrio bacter...
AAQ60133  88 -QRGSQLCRmNLIPTPEREKFAFFT---LTHMQLPLQLVIRRELAAQAPLNEAG-EVVLEKLILKPGLRGITAAGRSYTA 162 Chromobacterium vio...
CAE78991  94 -SGQGGYCTvLLQRTKEREKFLIFG--DELARAFPVGLVVHAKDTPGIRDEQK--DVDLKELLASGKFRLGVIQSRAYTQ 168 Bdellovibrio bacter...
AAN67096 163 QIDSILRQLPDSALSrHYGNEATAN-LLQMQQLGRLRLVLGYWPEVRYLIQ-------------QQGGALADYQFHTVQG 228 Pseudomonas putida ...
AAQ95751 156 KFDLAIKDKTNKRVN-YSLNAPMGN-VLDMLLKDVNGFTVAYPEEIIYYTEskfgygsstvsdlNKKAYLGKFKVLPIAG 233 Aeromonas hydrophila
CAE79207 151 GIDDVLIKNNYQKNPqVITIATSLR-VHKMLHSNRIQYTLGYPFEAVYYNK-------------LLDGKNNEVVHIPVTE 216 Bdellovibrio bacter...
AAQ60133 163 EIDRLLADRKGESNVrDIPNLPSNDgLFKLLELGRADYTLDYEPNFKYREE---------------QNRDHPLASLPIAG 227 Chromobacterium vio...
CAE78991 169 QIDDILSHSG--HATkIVGDSAMGN-LFLMLEKKRVNGVLAYALEKTDYER--------------NNIAVPPLKFLKVKN 231 Bdellovibrio bacter...
AAN67096 229 VNRYQFLHVGCSNSELGRAAVAHIDQLLPTLRRD-VLPGLYARWLDLALREDY 280 Pseudomonas putida KT2440
AAQ95751 234 QPKEISTYVAAPKTEWGDKVISDINEALSKLKSNpAYINENYMWRNLPNHDMR 286 Aeromonas hydrophila
CAE79207 217 NAARVEVVVACPKTPWGAKVIADIDQVLQNRALLeKFEKGVDRWLSIEDQEKL 269 Bdellovibrio bacteriovorus HD100
AAQ60133 228 -AALIPVGIACPRTRWGRMAVMKIDQLLSEAVADpAYRQAQDRWLSPESVQRY 279 Chromobacterium violaceum ATCC 12472
CAE78991 232 MPNHISVWASCEKSLRGEQILKDLTRAVREKNVKgKIYKYFMQELPPDMKKGY 284 Bdellovibrio bacteriovorus HD100
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap