Conserved Protein Domain Family
TIGR02284

?
TIGR02284: TIGR02284 
conserved hypothetical protein
Members of this protein family are found mostly in the Proteobacteria, although one member is found in the the marine planctomycete Pirellula sp. strain 1. The function is unknown.
Statistics
?
PSSM-Id: 131337
View PSSM: TIGR02284
Aligned: 4 rows
Threshold Bit Score: 184.653
Threshold Setting Gi: 21112373
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAO54828   8 TISILNDLIETSIDGKEGFQTSAENAKTPSVKTFFTRRSAEVGAAVTELQQHVQQLGGKPEDSSSVSADLHQAWVKLKTA 87  Pseudomonas syringa...
CAD73728  13 TIEKLQKLIRANIDSYNGFHESAEELKDERLATLFRSIGDERSAMASELQQYVEFNGKEAEDDGSVAAKTHRIWINIRGK 92  Rhodopirellula balt...
CAD15870   8 IVLALNRLIEVGKNDELSCSSGAREVHDPQLRDILTDAAQSCRASVQELQQLVRSLGGQPRDRGSMNGTLHRGWMEIRHL 87  Ralstonia solanacea...
AAM40616   7 TEHSLNDLIAISRDGKDFYEEAASKVGDAELATLFRRIAGVKSDIVSNLSSVVASVGGKPETHGTMVGSMQQFYGKVRAT 86  Xanthomonas campest...
AAO54828  88 FTSNDDLAVLEEAERGEDVAKKAYSKALEKSrekgVSPAVIAVIEKQYQGVLKNHDEVKALR 149 Pseudomonas syringae pv. tomato str. ...
CAD73728  93 LNGGDATVILIEAERGEDHIKEAYEDVLKDT----AGSAMNDVLTAQYAKVKAGHDKIRDLR 150 Rhodopirellula baltica SH 1
CAD15870  88 ITPNDDDVVLEMCEREEDIARHEYQTTLQQD----LPAEIRAVVQRQYEGIQLHRERIHAMR 145 Ralstonia solanacearum GMI1000
AAM40616  87 LG-DTKYGYVAELEESEDRLLKAFDETIADQd---TPAAARDAALRLLPEVRACHDVMRNRK 144 Xanthomonas campestris pv. campestris...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap