Conserved Protein Domain Family
clan_AA_DTGA

?
TIGR02281: clan_AA_DTGA 
clan AA aspartic protease, TIGR02281 family
This family consists of predicted aspartic proteases, typically from 180 to 230 amino acids in length, in MEROPS clan AA. This model describes the well-conserved 121-residue C-terminal region. The poorly conserved, variable length N-terminal region usually contains a predicted transmembrane helix. Sequences in the seed alignment and those scoring above the trusted cutoff are Proteobacterial; homologs scroing between trusted and noise are found in Pyrobaculum aerophilum str. IM2 (archaeal), Pirellula sp. (Planctomycetes), and Nostoc sp. PCC 7120 (Cyanobacteria). [Protein fate, Degradation of proteins, peptides, and glycopeptides]
Statistics
?
PSSM-Id: 131334
View PSSM: TIGR02281
Aligned: 12 rows
Threshold Bit Score: 158.591
Threshold Setting Gi: 28855329
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
tigr:BR0864  114 TVTLAKSANGHFEVNGRVNGARVHFLVDTGASSVVLSQEDAERAGIDTASLNYSVPIMTANGQARAASITIATLQIGDIE 193 Brucella suis 1330
BAB48127     115 TVTLDKADNGHFEARILVNGKPVRAVVDTGATSTVLTSEDAQAAGFNPAALNYTIPVSTANGMARAAAVKTDAVAIGGIV 194 Mesorhizobium l...
CAC46466     113 EVVLHKRIDGHFAADATINGREVSMLVDTGASSVVLTHEDAARAGLEVADLGYTITVMTANGPALAAPVILPEIAIGPIR 192 Sinorhizobium m...
AAK23288      53 AAQLSKDSDGHFWAQGNVDGKAVRFLVDTGATAVSLSLADAQRLGIDTSRLTYDYNVITADGRTRAAAVKLASVSIAGAR 132 Caulobacter cre...
Q9ZC99       113 EIIIARSGDGHFYINACVNNVKIKFMVDTGASDIALTKEDAQKLGFDLNKLKYTRTYLTANGENKAAPIILNSVVIGTEF 192 Rickettsia prow...
AAS13980      52 SIEFTKSYDGHFYIQAQVNDRNITFLLDTGATDIVLSQKDALHVGINLQNVQDFKIYETAKGQIKAGVVQIPQVKIGNFL 131 Wolbachia endos...
BAC49001      48 AVQIQRGQGGEFALRAKINGVAAPMVIDTGATSVVLTWETAKAIGLPLEMLEYDVDLETAGGHTKAARLTLDRLAVGHLV 127 Bradyrhizobium ...
AAO58389      58 EVQLVGNRQGHFVSTGQINGRTVEFMIDTGATDVAIPGDMADSLGLKR---GLPVTVSTANGNSQGFRTTLDRLQLGDIV 134 Pseudomonas syr...
BAB50112      67 KVAVTADGRGHFSTTFKLNGRQVDGMIDTGATLVAVNTSTARRIGLSLNPSDFSHEVNTANGSIKAAVVTIDRLQIGSIS 146 Mesorhizobium l...
BAC53392      51 SLAIGRDGRGHFQTEGRIEGQRIGFMVDTGASVVALNETSAARFGLRPSRGEYNATVSTANGTIKAARTRIAMLEVGGLV 130 Bradyrhizobium ...
WP_010970673  58 SVSLKADERGHFNATFRINGKSFDGLVDTGASMVAINETMARRLGYGVNSLDFKYAISTANGQTLAAHVKLDRVEIGAIR 137 Agrobacterium f...
WP_003102820  93 SFSIARGTGGHYWVAGSVNGQNMQFLVDTGATSIAMNENEARRLGIDYRVDGKPMVASTASGTSRGWRVTLDRVKIGGIE 172 Pseudomonas aer...
tigr:BR0864  194 RHDVRAMVTKEGLLTGSLLGMNFLQTLGGFTVRGDQLILIN 234 Brucella suis 1330
BAB48127     195 RKDMPVMVAAPGMLSQSLLGMNFIGSLSGFDVRGDRMILRD 235 Mesorhizobium loti MAFF303099
CAC46466     193 RTNIRAMVAAEGRLDSSLLGMSFLSTLDFLQMRSDELRLRD 233 Sinorhizobium meliloti 1021
AAK23288     133 VRDVDALVIEKG-LENSLLGMSYLGRLSRFEATQTSLILHP 172 Caulobacter crescentus CB15
Q9ZC99       193 KN-IKGHVGLGN-LDISLLGMSLLERFKGFRIDKDLLILNY 231 Rickettsia prowazekii str. Madrid E
AAS13980     132 INDVQASVNTHS-MSHSLLGMSFLRYFH-FTIRDNKLILYR 170 Wolbachia endosymbiont of Drosophila melanogaster
BAC49001     128 EKSVPALVVQRGQMKTNLLGMSFLDRLESWGVRADKLMLTG 168 Bradyrhizobium diazoefficiens USDA 110
AAO58389     135 LHNVRALVAPGLEGEQVLLGMSALKQLE-FTQRGGNLLLRQ 174 Pseudomonas syringae pv. tomato str. DC3000
BAB50112     147 VDDVQAIVLDDKALSTNLIGMSFLNRLGKYQAENGTLLLVQ 187 Mesorhizobium loti MAFF303099
BAC53392     131 VRDVDAMVLPDEALSENLLGLSFLSRLKRFEYANGQMVLEQ 171 Bradyrhizobium diazoefficiens USDA 110
WP_010970673 138 VQNVDTMVLKDNALSNMLVGMSFLKQLSSFKVSGGEMRLVR 178 Agrobacterium fabrum
WP_003102820 173 LLGVEAAVIEGGYPTEALLGMSFLNRV-RWREEQGMLLIEA 212 Pseudomonas aeruginosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap