Conserved Protein Domain Family
PaaN-DH

?
TIGR02278: PaaN-DH 
phenylacetic acid degradation protein paaN
This enzyme is proposed to act in the ring-opening step of phenylacetic acid degradation which follows ligation of the acid with coenzyme A (by PaaF) and hydroxylation by a multicomponent non-heme iron hydroxylase complex (PaaGHIJK). Gene symbols have been standardized in. This enzyme is related to aldehyde dehydrogenases and has domains which are members of the pfam00171 and pfam01575 families. This family includes paaN genes from Pseudomonas, Sinorhizobium, Rhodopseudomonas, Escherichia, Deinococcus and Corynebacterium. Another homology family (TIGR02288) includes several other species.
Statistics
?
PSSM-Id: 131331
View PSSM: TIGR02278
Aligned: 4 rows
Threshold Bit Score: 1090.25
Threshold Setting Gi: 46196536
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAE27166   5 LQSLACDRWETPATGL--VDIPSAIDGRVVARASSAGLDFAAIARHARQVGGPKLRAMTFHQRADMLKALGAYLGERKEQ 82  Rhodopseudomonas pa...
P77455     4 LASFLSGTWQSGRGRS--RLIHHAISGEALWEVTSEGLDMAAARQFAIEKGAPALRAMTFIERAAMLKAVAKHLLSEKER 81  Escherichia coli K-12
AAS80952   3 LQSYLMGEWREGQGEG--VPVRDASTGEVLARVTAEGLPVKEAVAWGREVGGRALLALGFQERGRRLRALAQYLSERKEA 80  Thermus thermophilu...
BAC17487  23 VPSYLSGQWVTPDNPTriAEVADASTGEIVARVSTDGLDIGAAVAYARDMGQKNLRELTLHERALKLKELALYLSEHKQE 102 Corynebacterium eff...
CAE27166  83 LYALAADTGANRRDNAIDIDGSLVTLAAFASRGRRELPDAGFITEGEVEALSKRGSFVGQHILTPLHGVAVHINAFNFPC 162 Rhodopseudomonas pa...
P77455    82 FYALSAQTGATRADSWVDIEGGIGTLFTYASLGSRELPDDTLWPEDELIPLSKEGGFAARHLLTSKSGVAVHINAFNFPC 161 Escherichia coli K-12
AAS80952  81 LYRLYATTGGTRRDAWYDVDGGIGVLYTYSSLARN-LPEGNLLPEDDFLPLSKDLSFQGRHVLAPKGGITVQINAFNFPV 159 Thermus thermophilu...
BAC17487 103 LYEIAYCTGATKRDNGVDIDGGISTLFTYSSKGRRELPNADVIIDGPTEVLSKDSSFQGTHIYTPLPGVAVQINAFNFPV 182 Corynebacterium eff...
CAE27166 163 WGLLEKLAPALLAGVPVIAKPATATAYVAEALVKMIDESKLLPQGALQLVCGGLGDLLDHLNGQDVIAFTGSLETSEKLR 242 Rhodopseudomonas pa...
P77455   162 WGMLEKLAPTWLGGMPAIIKPATATAQLTQAMVKSIVDSGLVPEGAISLICGSAGDLLDHLDSQDVVTFTGSAATGQMLR 241 Escherichia coli K-12
AAS80952 160 WGLLEKFAPAFLAGVPTLAKPATPTAHVAEALVRTMLESGLLPEGSLQLLVGSVGDLFDALDHRDSVFFTGSKATADRLR 239 Thermus thermophilu...
BAC17487 183 WGMLEKFAPSFIAGVPSLVKPATPTGYVTQACVRLMVESGILPEGSIQLISGSARDLLDHLDYRDHVAFTGSATTAATLR 262 Corynebacterium eff...
CAE27166 243 AHPNVARHSIRFIAERDSLNAAVLGPDIKPADPEFDLFAHEIVREMTAKAGQKCTAIRRVLVPRAQEAAVIEALKARL-A 321 Rhodopseudomonas pa...
P77455   242 VQPNIVAKSIPFTMEADSLNCCVLGEDVTPDQPEFALFIREVVREMTTKAGQKCTAIRRIIVPQALVNAVSDALVARL-Q 320 Escherichia coli K-12
AAS80952 240 RHPAFLERGALFNAEADSLNPAILGEKAT--EEELSRLAQEIAQELVIKTGQRCTAIRRVFAPKDRLEALLKATQKRL-E 316 Thermus thermophilu...
BAC17487 263 AHDNVQHAGLRFSAEADSVNAAILGEDATPDTPEFDAYVKTLFNELTSKAGQKCTAVRRAIVPTGLIDDVAFALADRItA 342 Corynebacterium eff...
CAE27166 322 DVKLGDPRRDDKAMGPLVSRGQREAVRAAIATLQSE-AEIVFGDPNVCEaegidtqaGAYMSPVLLRAREPmQASHVHAT 400 Rhodopseudomonas pa...
P77455   321 KVVVGDPAQEGVKMGALVNAEQRADVQEKVNILLAAgCEIRLGGQADLSa------aGAFFPPTLLYCPQPdETPAVHAT 394 Escherichia coli K-12
AAS80952 317 ALRLGDPREEGVDLGPLASLEQKAEVEKAVAALLEAgARVYWRHPGRED--------GAFFPPTLLLAEDP-WPGALHQV 387 Thermus thermophilu...
BAC17487 343 KIVVGDPRDEKTTMGPVVSVEQRDDVAAAVDKLIAAgGTVRLGGPEELD--------GAFFAPTILTFDNA-DADAVHDT 413 Corynebacterium eff...
CAE27166 401 EAFGPVATVLAYDDVAQAVELVRRGEGSLVASLFTYDDVVAEQMILGLAPFHGRLLIVDRDDAAESTGHGTPLPALLHGG 480 Rhodopseudomonas pa...
P77455   395 EAFGPVATLMPAQNQRHALQLACAGGGSLAGTLVTADPQIARQFIADAARTHGRIQILNEESAKESTGHGSPLPQLVHGG 474 Escherichia coli K-12
AAS80952 388 EPFGPVATFFPYGSREEAARLAALGGGSLVATLATSDPEEARFYLLALAPYVGRLHLLNARTAASSTGHGSPLPRLLHGG 467 Thermus thermophilu...
BAC17487 414 EAFGPVVSIIGYSDTADAIRLAARGQGSLVASVITHDPALANQFAMGIAAHHGRLHFLDRDDARTSTGHGSPLPHLIHGG 493 Corynebacterium eff...
CAE27166 481 PGRAGGGEELGGLRSVYHYMQRTAIQCSPRRLARLTGTWTRGAPAP---------AAEVHPFKLNYNQLEIGQSIETASR 551 Rhodopseudomonas pa...
P77455   475 PGRAGGGEELGGLRAVKHYMQRTAVQGSPTMLAAISKQWVRGAKVE---------EDRIHPFRKYFEELQPGDSLLTPRR 545 Escherichia coli K-12
AAS80952 468 PGRAGGGEELGGLLSVRRHLGRVALQADPWLLSALTGEYAKGAEKP----------AEVHPFRKPYEDLEVGETLTTHRR 537 Thermus thermophilu...
BAC17487 494 PGRAGGGEELGGIRGVKHYMQRTAIQGTPDHLTAITGQWHRGAAVNrvtradvtaGTGVHPFRKDLATLRIGDQFASDLR 573 Corynebacterium eff...
CAE27166 552 PITLDDIEHFAHFTGDTFYAHMDEAAAKANpFFPGRVAHGYLILAFAAGLFVDPAPGPLLANYGLDNLRFLKPVSPDDSI 631 Rhodopseudomonas pa...
P77455   546 TMTEADIVNFACLSGDHFYAHMDKIAAAES-IFGERVVHGYFVLSAAAGLFVDAGVGPVIANYGLESLRFIEPVKPGDTI 624 Escherichia coli K-12
AAS80952 538 TVTEADIALFSALSWDHFYAHTDEIAARES-LFGKRVAHGYFVLSAAAGLFVDPAPGPVLANYGLEGLRFLEPVGAGDTL 616 Thermus thermophilu...
BAC17487 574 KVSLEEILEFAEKTGDTFYAHVDEEAAMANpFFPRRVAHGYLLVSWAAGLFVEPQPGPVLANYGLENLRFITPVTYDDSI 653 Corynebacterium eff...
CAE27166 632 KVKLTVKQKSPARRPEYG-----EVRWDVEVVNQNGEPVARYDLLTMSAR 676 Rhodopseudomonas palustris CGA009
P77455   625 QVRLTCKRKTLKKQRSAEekptgVVEWAVEVFNQHQTPVALYSILTLVAR 674 Escherichia coli K-12
AAS80952 617 QVRLTVKRKRPRDEKTG------VVEWAAEVVNQEGKPVATYTVLTLVAR 660 Thermus thermophilus HB27
BAC17487 654 RVELTAKRITPRVTDDYG-----EVCWDAVLYNQNDEIVASYDVLTLAEK 698 Corynebacterium efficiens YS-314
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap