2D40


Conserved Protein Domain Family
gentisate_1_2

?
TIGR02272: gentisate_1_2 
Click on image for an interactive view with Cn3D
gentisate 1,2-dioxygenase
This family consists of gentisate 1,2-dioxygenases. This ring-opening enzyme acts in salicylate degradation that goes via gentisate rather than via catechol. It converts gentisate to maleylpyruvate. Some putative gentisate 1,2-dioxygenases are excluded by a relatively high trusted cutoff score because they are too closely related to known examples of 1-hydroxy-2-naphthoate dioxygenase. Therefore some homologs may be bona fide gentisate 1,2-dioxygenases even if they score below the given cutoffs.
Statistics
?
PSSM-Id: 131325
View PSSM: TIGR02272
Aligned: 6 rows
Threshold Bit Score: 609.475
Threshold Setting Gi: 3550667
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2D40_A    20 SREQFYQHISGQNLTPLWESLHHLVPKTPNANCAPAYWNYQEIRPLLLESGGLIGAKEAVRRVLVLENPALRGQSSITAT 99  Escherichia coli O1...
CAA12267  12 QLTALYDEMRPAGLKPLWEVLHALVLAEPASLARAHHWHYGEVRDFLLRSGDLISAEQAERRVLILENPGLEGSSAITPS 91  Sphingomonas sp. RW5
AAO68375  11 SRQQYYQHISGQNLTPLWESLHHLVPQTPNANCAPAYWNYQEIRPLLMESGNVIGAKEAIRRVLVLENPALRGQSSITAT 90  Salmonella enterica...
AAD49427  12 ERKEFYSKLESHDLAPLWEVLNEVVTTKPKSNCAPHLWEFEVAKEFLMEAGTLITAKEAERRVLILENPGLKGLSRITTS 91  Pseudomonas alcalig...
BAC45375   9 EREAFYKKIDGENLTALWTVMGDLITPEPKSACRPHLWKFDVIRDYMREAGKLITAKEAERRVLVLENPGLRGQSKITTS 88  Bradyrhizobium diaz...
CAD14789   9 ERDTYYSLLGGMGLAPLWESLHALVPREPKPRIVPAHWQYAAIRPLVMQAGRIISAEEAVRRVLVLENPGLPGRSSITST 88  Ralstonia solanacea...
2D40_A   100 LYAGLQLIXPGEVAPSHRHNQSALRFIVEGKGAFTAVDGERTPXNEGDFILTPQWRWHDHGNP----GDEPVIWLDGLDL 175 Escherichia coli O1...
CAA12267  92 LYAGLQLILPGEVAPCHRHTQCALRFILEGEGAYTAVDGEKAVMSPFDLVLTPGGQWHDHGNG----TDQPMIWLDGLDI 167 Sphingomonas sp. RW5
AAO68375  91 LYAGLQLILPGEVAPSHRHNQSALRFIVEGKGAFTAVDGERTPMHTGDFILTPQWRWHDHGNP----GSEPVVWLDGLDL 166 Salmonella enterica...
AAD49427  92 LYAGLQLILPGEVAPTHRHSQSALRFVVDGGGACTSVDGERTTMQVGDFVITPPWAWHDHVND----SDKPMIWMDGLDL 167 Pseudomonas alcalig...
BAC45375  89 LYAGVQMVVPGDVAPAHRHSQSALRFVLEGKGAHTAVDGERTAMEPGDFIITPSMTWHDHSNE----TDEPMFWLDGLDI 164 Bradyrhizobium diaz...
CAD14789  89 LYAGLQLILPGEIAPSHRHTQSALRFIVEGKGAWTAVDGERTTMHPGDFIITPSWTWHDHGCPrldeGGEPVVWLDGLDI 168 Ralstonia solanacea...
2D40_A   176 PLVNILGCGFAEDYPEEQQPVTRKEGDYLPRYAANXLPLRHQTGN----SSPIFNYRYDRSREVLHDLTRLGDADEWDGY 251 Escherichia coli O1...
CAA12267 168 PTVRHFDASFAEKWPQAQHPEMAPPGDSLARYGHNLRPMRGTSADrrptSQPLFHYPYKQWRPALDHLASTAQVDPHLGH 247 Sphingomonas sp. RW5
AAO68375 167 PLVNLLGCGFAEDYPEDQQPVTRKEGDYLPRYAANMLPLRHQRGN----SSPIFNYRYDRSREALHDLTRMGDPDEWEGY 242 Salmonella enterica...
AAD49427 168 PMVTLFDTSFAEGYGEDIQEITRPNGDSLARYGANMLPVDFKQKGl---SSPIFNYPYERSREALEAMKKANEWDPCHGL 244 Pseudomonas alcalig...
BAC45375 165 PLVQFFDCSFAEGSKEDQQRITKPAGDSFARYGHNLLPVDVKRSSk---TSPIFSYPYAYTREALEKARASQEWDACHGL 241 Bradyrhizobium diaz...
CAD14789 169 PLVQQFDAGFAENHPEAQQPVTRPEGDSFARFGHNMVPVRHRVSDp---TSPVFSYPYERSREALDTLYRHGELDPWDGV 245 Ralstonia solanacea...
2D40_A   252 KXRYVNPVTGGYPXPSXGAFLQLLPKGFASRVARTTDSTIYHVVEGSGQVIIGNETFSFSAKDIFVVPTWHGVSFQTTQD 331 Escherichia coli O1...
CAA12267 248 ALEFTNPADGGPVMETISAHVRLIPRGMETAPRRSTDGTIFVVVEGKGQVEIDGVSTRLSPRDVVVIPSWKRHRFHAEDE 327 Sphingomonas sp. RW5
AAO68375 243 KLRYVNPVTGGYPMPSMGAFLQLLPKGFASRVARSTDSTIYHVVEGAGQVTIGNETFHFSAKDIFVAPTWHEVSFRSSED 322 Salmonella enterica...
AAD49427 245 KMQYINPLDGMAAMPTISSFIQLLPKEFRTQTYRSTDATVFSVIEGQGKTRIGDKVFFWKAKDTFVVPSWYPVEHEASSD 324 Pseudomonas alcalig...
BAC45375 242 KLKFSNPETGDFAMPTIGTFIQLLPKGFKTARYRSTDATVFCPIEGRGRSRIGDAVFEWGPRDLFVVPSWHWVTHEADDD 321 Bradyrhizobium diaz...
CAD14789 246 KLRYVNPATGGWPMPTIATFMQYLPAGFRGKTYRSTDATVYCVVEGRGTAHIGEARFAFAPHDVFVVPSWAPVRLDAQDD 325 Ralstonia solanacea...
2D40_A   332 SVLFSFSDRPVQEALGLFREAR 353 Escherichia coli O157:H7
CAA12267 328 LIIFGFSDKACQQKLGLFREEN 349 Sphingomonas sp. RW5
AAO68375 323 TVLFSFSDKPVQEALGLFREAR 344 Salmonella enterica subsp. enterica serovar Typhi str. Ty2
AAD49427 325 AVLFSYSDRVAQQKLGFWRESR 346 Pseudomonas alcaligenes
BAC45375 322 AVLFSFSDRPVQQKLDLFREDR 343 Bradyrhizobium diazoefficiens USDA 110
CAD14789 326 AVLFSYSDRPVLAALNLLREAR 347 Ralstonia solanacearum GMI1000
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap