Conserved Protein Domain Family

TIGR02271: TIGR02271 
conserved domain
This model describes an uncharacterized domain, sometimes found in association with a PRC-barrel domain (pfam05239, which is also found in rRNA processing protein RimM and in a photosynthetic reaction center complex protein). This domain is found in proteins from Bacillus subtilis, Deinococcus radiodurans, Nostoc sp. PCC 7120, Myxococcus xanthus, and several other species. The function is not known.
PSSM-Id: 131324
Aligned: 4 rows
Threshold Bit Score: 117.235
Threshold Setting Gi: 499266711
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
P94560       227 VVTDEVVVGKRTVEENEHISETVKKEEPRLNKEGK 261 Bacillus subtilis subsp. subtilis str. 168
BAC90692     267 VVSEEVTVGKRDVQETEQVTDTVRHEELRTDTEGE 301 Gloeobacter violaceus PCC 7421
WP_010964105 104 VLTSEVSAHKHDVEDTHHVDETLKREEARVNRTGD 138 Clostridium acetobutylicum
WP_010964104  83 IILEDVSIYKNQIEDVRHIEETLKKENPKIETFGN 117 Clostridium acetobutylicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap