Conserved Protein Domain Family
TIGR02268

?
TIGR02268: TIGR02268 
Myxococcus xanthus paralogous family TIGR02268
This family consists of at least 8 paralogs in Myxococcus xanthus, a member of the Deltaproteobacteria. The function is unknown.
Statistics
?
PSSM-Id: 131321
View PSSM: TIGR02268
Aligned: 5 rows
Threshold Bit Score: 308.338
Threshold Setting Gi: 499872496
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011554479   8 FFVVLVLASGAATAQPSPTVSGLGVRRVEISAEPSSavPPPEVQISPRMSTSFEFDSALDPAKVVLEGEE-RFSLVDLGR 86  Myxococcus xanthus
WP_011552475  10 LAWGLLWATLAESAAVEAPAGAAVVRRIDVQAGGLA--TPPEVRISPGLSTTLFFDARIRPEQLALEGRE-RFQRFGVTE 86  Myxococcus xanthus
WP_011557187   9 MTAVVLLLGTAALAQTPDTKRWRRIERAMVLSASAGe-PVQRLRLAPGVVTTVLLDSDAVLEGELPEALHgLFTRLDVTE 87  Myxococcus xanthus
WP_011554375  11 lalalllaaepTRAQP-ATCREPTERPVELGAERCG--RPPEIRVGEGVATVLRFDTPLMRAEVSGPG---RFRQV-VDR 83  Myxococcus xanthus
WP_011553230   8 ALALALVWGAAVEAQPSAAARMRRERVVTVPGAAAE--PLPVVHVAHDTPTLLLFPAPINRKTLTFDES--RIRILDAGE 83  Myxococcus xanthus
WP_011554479  87 STLRLVPSEQLLPGERLLLTVRFQDGSVPLDAAFVLVAH-PARGERIVEVWRQARTAESYQQEAKEARAETQQCHEENAR 165 Myxococcus xanthus
WP_011552475  87 DHLVLVPSPTFREGERLRLEVRFHDGAVPDRAVLDLVVD-ATRPERQVEIYRHARSAASYRQEVEELRAGMLRLERQVQQ 165 Myxococcus xanthus
WP_011557187  88 THLLLQPAVAMPARGVPPLVLRFTDAAAPQRLVLELTTE-ANVVDSVIDVRRHPATVTQLEAELVALRERNALLEARLAT 166 Myxococcus xanthus
WP_011554375  84 ELLILVPEEPVADESRATLTVYFADGAVPIQATLQLVIEtPARAERQVELFRRARTAASFQRELLETRRVLQEVREENAR 163 Myxococcus xanthus
WP_011553230  84 RSVIVQPVADLPEGERYEVGVFFADGRAPARAAFSLVTD-PAEVDTRIDVQRPELADMACPVDVPRT------------- 149 Myxococcus xanthus
WP_011554479 166 MRAEQREPSGIAGLLANGVIQKEEGVAAKLLRvneevRQHPGNALWAHRAWSYRAPVRVAVAVEFENPDAANPWTAEGAS 245 Myxococcus xanthus
WP_011552475 166 LQRSRTGGEYTRESLVADILDESTVMFRHWAP-----RKVTGDFVVRRASLVRLSPGWAALRLSLLPSEAGKGWMAAGAA 240 Myxococcus xanthus
WP_011557187 167 ARRQVPHPG-LAGAILSGAIG-ITGVLGTWMD-----TPASEAELKVRQLDSYRSGSWVALAVNLENPPGEAPWQPGIAR 239 Myxococcus xanthus
WP_011554375 164 LRAAQARPGGLMGLWVSGDMGRTGVAAREFLDv----REHARNSLVLRSGLTFRARS-ILVVVGLKNPLGAKPWQATGAA 238 Myxococcus xanthus
WP_011553230 150 -----PRPE---DFVLLGYVDK-EGVTATPIKl----HADSERGFSVISAMAYRGQGWVLVDATIRNYPGRAPWVPREAM 216 Myxococcus xanthus
WP_011554479 246 LVSKPGT-----SLKILTVWQKAPISRYPFGRVVVEAEATPDAAQGPFTLKLWGPGGLRAITLSGVTF 308 Myxococcus xanthus
WP_011552475 241 LTDAQGN-----RMRTLPPWQEGPLDAAGSSPIIIVLEEPEAADFGRYTLELWDEGRKRTLKLEGFQA 303 Myxococcus xanthus
WP_011557187 240 LTSLDSNgrptgEPMELPLLLQEPRLLPGQSAVAVVQWPAPTRPPPAYALELWDTGRRRGVRWARLKP 307 Myxococcus xanthus
WP_011554375 239 LVGPDGA-----ELKVARVWAPASLNPGDEMDVLVETEPVEGAPRGPFTLTLWAEDGKRPIILGNIEF 301 Myxococcus xanthus
WP_011553230 217 LTGRAGLp----LRARLVTVDEGAFVPGGFGRILAVAETAQLSNSPVYTLEVVGDG--RTLTIPNVRL 278 Myxococcus xanthus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap