Conserved Protein Domain Family
TIGR02267

?
TIGR02267: TIGR02267 
DUSAM domain
This family consists of at least eight paralogs in Myxococcus xanthus and six in Stigmatella aurantiaca DW4/3-1, both members of Myxococcales order within the Deltaproteobacteria. The function is unknown. Some member proteins consist of two copies of the domain. This domain is hereby named DUSAM, DUplication in Stigmatella And Myxococcus.
Statistics
?
PSSM-Id: 131320
View PSSM: TIGR02267
Aligned: 4 rows
Threshold Bit Score: 115.338
Threshold Setting Gi: 499870504
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011554483   1 MPEHRTWHEIRELNRRVTDLGEPLVLTDENRALLTNTASEVAITPREVTQALQDDVSAAALLKEIAKRIRVGSRRLSRAI 80  Myxococcus xanthus
WP_011550893   1 MAEELDWDPIRALARRVLRNGEPLMLTIEVRELLARTAREVGLSQADATSALASDTSALELLRECSRRISEGSSRMVNAL 80  Myxococcus xanthus
WP_011554381   1 MSKTLDWNPIRALARRVLREGQPLVLSDEVRALLLRSAREVAIRDADVGRALATDVDALKLLEAISDRIRKGSLRLSRTL 80  Myxococcus xanthus
WP_011551238   1 MAESIDWDPVRELARRVEA-GEALSLTAEVRALLLRSAREVGIPEEDAHAAVAGVATATALLHETRRRIRDGSQRLMRAL 79  Myxococcus xanthus
WP_011554483  81 TEAIKHQEAGDLDAARAPFLELLNVEVVPFYRELAQVQLDALD 123 Myxococcus xanthus
WP_011550893  81 HRMYQHKRAGDLDSARQEMRDVLAAEEVPHYRAVAQGQLNLLD 123 Myxococcus xanthus
WP_011554381  81 SEAVRRRDAGDVDGARQLLHDALAVEVVPIYRDSLYAYVESLD 123 Myxococcus xanthus
WP_011551238  80 TGARRLRDAGDAAGARALLEDVLAVEQVPLYREQAELALEDME 122 Myxococcus xanthus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap