Conserved Protein Domain Family
Mxa_TIGR02265

?
TIGR02265: Mxa_TIGR02265 
Myxococcales-restricted protein, TIGR02265 family
This family consists of a set of at least 17 paralogous proteins in Myxococcus xanthus DK 1622. Members are about 200 amino acids in length. No other homologs are known; the function is unknown.
Statistics
?
PSSM-Id: 131318
View PSSM: TIGR02265
Aligned: 14 rows
Threshold Bit Score: 194.073
Threshold Setting Gi: 648422312
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011557319  52 LALVEASEGIRGMHFAAVLDTVRFLggeqAVAPIQ-Q-----GGdYPADLDTTEFYPVPPFMRVFFSAARLLAPQL-GgV 124 Myxococcus xanthus
WP_011551561   3 DELLIFEQTIEALFLRALHGRLTPE----CKARLR-Q-----AG-LDVDQKLRPAYTFDAWMTFLRITSEELFPQL-P-L 69  Myxococcus xanthus
WP_026114121   2 aERLVFPPIVEGLFVRGLSGRVTPL----LKEQLR-S-----EG-LDLDRPLLPAYSLEAWIRCVTLTAKALHPQE-P-D 68  Myxococcus xanthus
WP_011550800   2 PEKLVFEHTLEGLFVRGLGARVTPV----LRERLR-E-----VG-VDLERKLQPAYAFETWCFAVRVAARELHPDV-P-D 68  Myxococcus xanthus
WP_011554572   4 SEKLVFNQTVEALFVRALENRLTPA----CREHLR-R-----AG-LELDQKLERAYTLEQWKEFLRIAAGHVYGGV-P-A 70  Myxococcus xanthus
WP_011551115   3 SEKLMFAQSVEALFVRALGPYLTRD----GRQRLK-A-----VG-LDLSEPLRPQYTLEQWRAFLRVAAQDVFPAL-P-P 69  Myxococcus xanthus
WP_011550402  38 rlAATDDDMARGMFFQGTLDVVGFLggegAVARCK-G-----VA-GIWEINLLHMYPITRFLRMSSTAARLLAPQLdG-F 109 Myxococcus xanthus
WP_011556918  58 CALATPEDTARGMFFRGVLETVRRVggsaMEQLCRqP-----LP-EKRYIDFFS-YPITQFLPLAFQAAGLLSEHC-GgL 129 Myxococcus xanthus
WP_011557172   4 PEPLVFQQSFQGLL-RALGDDLDDA----CVGRLR-E-----AG-LDARGSLALAYPLKVWVAALKVAAATLAPEA-P-L 69  Myxococcus xanthus
WP_011553093  30 LSRAEEKDRARGMFFLGALDVVRME----VGEAAA-ArclaaSR-ERAFVPFFL-YPITSFLRLSFSAAGLLAPRL-GgF 101 Myxococcus xanthus
WP_011557319 125 EEAMRQLGVQGTLAFINSMFGAEVRQQVG-GEPKRLVEMLPEAYRMAINFGELQVAWTGPRSGRIHMRRIFTP-VAYNEG 202 Myxococcus xanthus
WP_011551561  70 EQGTWKLGEAYIEGFRETMLGRAVLSLLRvLGPRRTLMRATQNFRAGNNYTESKLRELGPTQFELWMNEVGPY-PAFTAG 148 Myxococcus xanthus
WP_026114121  69 EVAWRMLGERMIDGYRDTLMGRALLGVMKlLGPWRMLSKAQHGFRTSNNYTEVRITETGPTEAEVWLNEPGML-RYFKQG 147 Myxococcus xanthus
WP_011550800  69 DVGYALLGERLVDGYRETVLGRAAFGVIQlLGPRRCVSRARQMFRSGNNYTETRLDDVSPTEVDLWMNEAGAI-RYFTQG 147 Myxococcus xanthus
WP_011554572  71 EAAYYSLGERFMDAYFGTFFGRALLGVVRlAGPRRMLLRAGMGFRAGNNFSVVEIVERSPTSVELRMNDVLADlPTFSAG 150 Myxococcus xanthus
WP_011551115  70 HEASFALGARFLQGFRQTSVGRASLSLVTqLGPRRTLERVPYNVRAGNNFNEVRVEESTQDSATLWMKDVTADtPDFAAG 149 Myxococcus xanthus
WP_011550402 110 EGVLRRMGTQATVDFVASVFGRELMQAAS-GKPRLLLQSLGEAYLAAVTYGERYPLWTGETSARFIMRRDFMP-AAYHEG 187 Myxococcus xanthus
WP_011556918 130 AAAHRFMGQKAAHDFLESVAGRTLLMLAY-DEPRLLLGQLPTGFLAAVSYGERRMVWTGPRSGRFVMKRDFMP-TAYHEG 207 Myxococcus xanthus
WP_011557172  70 DEAAAVVGRRFVEGFSSTLIGNALLGTVRlLGPQRMLSRMTRNLRTGTNYLETHIEQLGPTRYELTCRPVVV--AGFYVG 147 Myxococcus xanthus
WP_011553093 102 EAAMRTIGARSAQDFLSTVVGRSFLALSG-GCPRRLVSNLPSGYSTAVSYGERDVEWVGERQGRLNMFRDFMP-HSYHEG 179 Myxococcus xanthus
WP_011557319 203 MLEGALLAVGAQDIQVRGGQTSLLDSEYTLSWD 235 Myxococcus xanthus
WP_011551561 149 IIHAGLRVAGAQDIVIEMSGYDGHACVYRINWN 181 Myxococcus xanthus
WP_026114121 148 VMLAMSRAAGGVAASVDVRAFDEHCVTYRVSWK 180 Myxococcus xanthus
WP_011550800 148 ALRAGLRAVGAPHAEVQVRAFTDEGVTYRLTWR 180 Myxococcus xanthus
WP_011554572 151 LLARAVELCGGGRVVSIPEEFDGTAATFHIRWS 183 Myxococcus xanthus
WP_011551115 150 FLAETLRSAGAGHVEVKPIAFDGTAATFRVTWS 182 Myxococcus xanthus
WP_011550402 188 VLHGVLEAVGAREVRVHGRQVGLLDSEYELSWK 220 Myxococcus xanthus
WP_011556918 208 VLHAALEAVGARDIGVQGRELGLLDTEYALSWR 240 Myxococcus xanthus
WP_011557172 148 LFLAGLEASGAKHPSVQIVRREGEEAVYDIAWS 180 Myxococcus xanthus
WP_011553093 180 VLRAALAAIGARDTHIRGRATGLLDGEYEVSWS 212 Myxococcus xanthus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap