Conserved Protein Domain Family
gmx_para_CXXCG

?
TIGR02264: gmx_para_CXXCG 
Myxococcus xanthus double-CXXCG motif paralogous family
This family consists of at least 10 paralogous proteins from Myxococcus xanthus that lack detectable sequence similarity to any other protein family. An imperfectly conserved CXXCG motif, a probable binding site, appears twice in the multiple sequence alignment.
Statistics
?
PSSM-Id: 131317
View PSSM: TIGR02264
Aligned: 5 rows
Threshold Bit Score: 362.556
Threshold Setting Gi: 499875059
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011555793   2 KFYRV--HPDTASGYTGSLD-AVNKWCLPGVHPCPVCRAGGGAPWLAYPCVDLSSL--PrdELKKLSDPWPV---SREEF 73  Myxococcus xanthus
WP_011551176   2 RFYRV--EASTTSRFTGNLSrAAHKWGLPGVEPCTECGVGGGWAGLQYPCVDLSSFskA--ELKPFSDPWPV---PFEVF 74  Myxococcus xanthus
WP_011556911  10 RIYQV--EAPRPSRYTGNLN-AAHRWSLPGLADCPGGGATWSTAGLHYPCVDLTSL--P--TRHEYEEPRPE---PYEEW 79  Myxococcus xanthus
WP_011550397   2 RFFEV--LEDEATRNTGRID-GVSPWCIPSID-CTVCG-GYGGLGEAYPTVDLARF--A--HRALLEEPRSQqalSLEAY 72  Myxococcus xanthus
WP_011556264   3 RFFWLreDSTVQAHTNGSLN-AAHKWGLPGLAGCPGCGETWASSGHQYPAVDLSVL--P--EQSAFLKARPE---PFTEF 74  Myxococcus xanthus
WP_011555793  74 SRLRALIAPMAPPWALLEPGAQFGPCEGKGAGRFGPLFMQDAPTLFVQrAAFERLNAAGVRGLQGASVEVRFRGKAPPEL 153 Myxococcus xanthus
WP_011551176  75 ARLRERVRPLAPEGAVLEPGTRLGPLSGVATGAFGHLALQDWTLVIRD-EALEVLQGEGVRGLTGCRLDVTFRGKNPPVL 153 Myxococcus xanthus
WP_011556911  80 ARLREQVRPQVPPGFALMPGTKFGPMTGRASGTFGQLHLQAWSLSLRR-EALEQLRQSGLQGLNGCPMQLKGSGRNPPEL 158 Myxococcus xanthus
WP_011550397  73 RHLCEQLRPWVPPAAPLEPGTQLGPVVGKAKGRFGDFYFQAPWAPWIRiSALEKLHAAGVRGLHGAPGDLGYRGQPAPPL 152 Myxococcus xanthus
WP_011556264  75 SRLRELVRPLAPPGALLPPGTTFGPLVGTASGRFGSFAWLGSSLLLIRhEELERLREEGIRGLLGARTELRFRQKDAPEL 154 Myxococcus xanthus
WP_011555793 154 LQLQLELHGLLHQACLPKEREPPCPACGAS-KQAWP-RTVVLDAASLPGDRDVFRHRQGWATVIVSERFVEAVNDLELDG 231 Myxococcus xanthus
WP_011551176 154 RELQLALHGRLHPDCFVHPRAPTCAKCGSEaSERLP-DTYWLARETLPVEVDLFRLRDYPALVIATERMVVAADRLKLEG 232 Myxococcus xanthus
WP_011556911 159 LELQLTPCGRFHPDCLPSDREPPCPTCGVE-SYGLP-APYLLDTTSIPTTVDVFRLADWPTLILATQRFVDAVQRLELDG 236 Myxococcus xanthus
WP_011550397 153 HCLEVLVHGALHPTSHTPDWQAPCPRCGSH-RNGYPsESAVLAASTLPENIDLFRLRDFKTVIVASERFVEAVKQLRLSD 231 Myxococcus xanthus
WP_011556264 155 LELQLDPRGQLHADCMPPDLPPRCATCGRL-GFRRP-DEPILDAASLPVDVDLFRVGNFATMIVGTERFMETVRRLELDG 232 Myxococcus xanthus
WP_011555793 232 VTFEELEVR 240 Myxococcus xanthus
WP_011551176 233 VTFQPLDAR 241 Myxococcus xanthus
WP_011556911 237 VTFRQVAAR 245 Myxococcus xanthus
WP_011550397 232 IAFRELSVR 240 Myxococcus xanthus
WP_011556264 233 VSFRELPTH 241 Myxococcus xanthus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap