Conserved Protein Domain Family
benz_CoA_red_C

?
TIGR02263: benz_CoA_red_C 
benzoyl-CoA reductase, subunit C
This model describes C subunit of benzoyl-CoA reductase, a 4-subunit enzyme. Many aromatic compounds are metabolized by way of benzoyl-CoA. This enzyme acts under anaerobic conditions.
Statistics
?
PSSM-Id: 131316
View PSSM: TIGR02263
Aligned: 2 rows
Threshold Bit Score: 822.326
Threshold Setting Gi: 3724168
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAE26101   9 TADIIARCEALFSDLSFTAAREWKAAEPGRIVVGFLPYYAPRELVHAAGGLPLGIFGGGDQLEVIHGDAYYQSYICRIPR 88  Rhodopseudomonas pa...
CAA12247   3 TADIIARCEALYEDLDFTAARQWKEADPSRKVIAYMPVYVPREIIHAAGMLPLGIMGGGDGLEVIHGDAFYQSYICRIPR 82  Thauera aromatica
CAE26101  89 STIELGVSGRLDFVDGMMFPSICDVIRNLSGMWKLMFPSKGARYIDLPHNFDDDLGGEFYVSELRETCEWLSTLTGKPIT 168 Rhodopseudomonas pa...
CAA12247  83 STIELGLSKRMDFVDGMLFPSICDVIRNLSGMWKLMFPGKYVRYFDVPQNYRDDVGGNYYTAELNELREGLEHLSGRKIT 162 Thauera aromatica
CAE26101 169 SDAIRASIAVFNDNRRLIRALYQLRADEPWNVPSSELYLLLRAGMVIPVEEHNQMLADYLAAVRLQQRPIKDNSRVVICG 248 Rhodopseudomonas pa...
CAA12247 163 DDALRASIKVYNENRKLVQDVYGLRSREPWKVPSADVYLLMRAGLVLPVEEHNQMLKDYLAAAVKVEAQKRDNCRVIING 242 Thauera aromatica
CAE26101 249 MFCEQPPLNLIKSIELSGCYIVDDDFILVTRWENSDVALDGDPLSNLASAYLHDSKSTPPKYEPDEAKKGLYLVDSVRKN 328 Rhodopseudomonas pa...
CAA12247 243 SFCEQPPLNLIKSIELSGCYIVDDDYMIVHRFLRNEVSTAGDPMQNLSLAFLHESISTAAKYDDKEEDKGKYLLEQVRTN 322 Thauera aromatica
CAE26101 329 RAEGVIFAMTSFCDPGLLERPMLQAVLKSHGIPQIAFKYAENSGQMQPIREQAGTFADSI 388 Rhodopseudomonas palustris CGA009
CAA12247 323 AAEGVIFAAPSFCDPALLERPMLADRCSENKVPYISFKYAENSGQMQPIREQAGTFADSI 382 Thauera aromatica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap