Conserved Protein Domain Family
benz_CoA_red_B

?
TIGR02260: benz_CoA_red_B 
benzoyl-CoA reductase, bcr type, subunit B
This model describes B, or beta, subunit of the bcr type of benzoyl-CoA reductase, a 4-subunit enzyme. Many aromatic compounds are metabolized by way of benzoyl-CoA.
Statistics
?
PSSM-Id: 131313
View PSSM: TIGR02260
Aligned: 2 rows
Threshold Bit Score: 925.169
Threshold Setting Gi: 499469585
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAA12248       8 EVIKESSMVKQKEMIAGNYDRLTGTKESGEKVVSTFVPGNLNELIMCFDMVNNLPETNAIQNGMRKQSGGMIMDAEKAGH 87  Thauera aromatica
WP_011156225  13 EAIKDASMARQKQMVNAHYDRLASAKERGEKVAATFVPGNLNELLMCFDMVNNLPEVNAIQNGLRRQSGGYVMEAEKLGH 92  Rhodopseudomona...
CAA12248      88 SEDVCTYVKADIGMMGRGNIAPNGKPMPAPDMLLLSYTGCFTFMKWFELLRHEYKCPTVMLQIPYQGDGKITKNMRDFVV 167 Thauera aromatica
WP_011156225  93 SEDVCTYVKSDIGMMAKGNIGPNGKPLPDPDVLLLSYTGCFTFMKWFELLRRQYKCETIMFQTPYLADGRITKDMISYMV 172 Rhodopseudomona...
CAA12248     168 KQLKEEVIPMFEQVSGVKFDIDRLREYLKNSAKAEDDLVWVLESAKNRPSPIDAYFGGVYYIGPMFTAFRGTADAVEYYG 247 Thauera aromatica
WP_011156225 173 KQLRQDVIPKLERISGVKFDIDRLREYLRKSAKAEDDHVWVLQSAKHKPSPIDAYFGGIYYIGPIFGAFRGTDDAIEYYK 252 Rhodopseudomona...
CAA12248     248 LLRGEIEQRIREGKGPITPEGDMKEEKYRLVVEGPPNWTSFREFWKLFYDEGAVVVASSYTKVGGLYDQGFRHDPNDPLG 327 Thauera aromatica
WP_011156225 253 FLRAEVEQRIAQGKGPVTPDGDMGQERYRLVVEGPPNYTNFRQFWKMFYDEGAVVVASSYTKVGGTYDYGFRHDPDRPLE 332 Rhodopseudomona...
CAA12248     328 TLADYCLGCYTNNNLPQRVELLEKYMNEYQADGLLINSIKSCNSFSAGQLLMMREIEKRTGKPAAFIETDLVDPRYFSHA 407 Thauera aromatica
WP_011156225 333 SLAEYCLNVYTNRNLPMRVDMLENYINEYEADGLLINSIKSCNSFSAGQLLMMREVEKRTGKPAAFIETDLVDPRYFSAA 412 Rhodopseudomona...
CAA12248     408 NVKNRLESYFQMV 420 Thauera aromatica
WP_011156225 413 NVKNRLESYFQMI 425 Rhodopseudomonas palustris
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap