Conserved Protein Domain Family
benz_CoA_red_A

?
TIGR02259: benz_CoA_red_A 
benzoyl-CoA reductase, bcr type, subunit A
This model describes A, or gamma, subunit of the bcr type of benzoyl-CoA reductase, a 4-subunit enzyme. Many aromatic compounds are metabolized by way of benzoyl-CoA. This family shows strong sequence similarity to the 2-hydroxyglutaryl-CoA dehydratase alpha chain and to subunits of different types of benzoyl-CoA reductase (such as the bzd type).
Statistics
?
PSSM-Id: 131312
View PSSM: TIGR02259
Aligned: 2 rows
Threshold Bit Score: 835.443
Threshold Setting Gi: 499469586
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAA12249       1 MECFVGIDLGSTTTKAVVMDDKGQVLGRGITNSRSNYDTAARVSKLEAFIDARLSLIRRELDKEPAVAGRVDEIIDGLTR 80  Thauera aromatica
WP_011156226   1 MRTFVGIDLGSTTTKAVLMDENKEVIGRGITNSRSNYATAARVASEEARIDARFTLFRRALHVGEAGHEHSAEFLAALER 80  Rhodopseudomona...
CAA12249      81 NFRREQFIEQLGDLEQTCVANVEGPRFAGKEKAIVGALTEVFRRLReEEADKLFAPDAQRKSDFFRDLAGSRFMQIGEEV 160 Thauera aromatica
WP_011156226  81 NFRLIQFLEQLDDLEETCHRQLEAERFKAVAGPLQEALHVIFARLR-EEAASLYAPGAKRKSDFFRDIAGSRFHVHAEAV 159 Rhodopseudomona...
CAA12249     161 ARANGVEFDHLLHMYDKSIIEVENRPPSADMNRKFRSAMERVRGEMSSALD-TAALGAPIDAALEIDMSERYVVGTGYGR 239 Thauera aromatica
WP_011156226 160 AREMGIALEMVLNAYDKSIIEVENRPPGGELSEKFRRAVARMLAVDSHAADgEGDFAAMIESALGIELEETYLVGTGYGR 239 Rhodopseudomona...
CAA12249     240 VRLPFPKEHIRSEILCHGLGAHLMYPKTRTVLDIGGQDTKGIQIDDKGIVVNFQMNDRCAAGTGRYLGYVADEMNMGLHE 319 Thauera aromatica
WP_011156226 240 VTLPFSKEHIRSEILCHGLGAHMMYPGTRTVLDIGGQDTKGIQIDGHGIVENFQMNDRCAAGCGRYLGYIADEMNMGLHE 319 Rhodopseudomona...
CAA12249     320 LGPLAMKSTKSIRINSTCTVFAGAELRDRLALGDKREDILAGLHRAIMLRAMSIISRSGGITDQFTFTGGVAKNEAAVKE 399 Thauera aromatica
WP_011156226 320 LGPLAMQSSRPARINSTCTVFAGAELRDRLSLGEKREDILAGLHRAIILRAISIISRSGGVTDQFTFTGGVAKNEAAVRE 399 Rhodopseudomona...
CAA12249     400 LRQLVKENYGEVQINIDPDSIYTGALGASEFA 431 Thauera aromatica
WP_011156226 400 LRKLIQENYGEVTININPDSIYTGALGASEFA 431 Rhodopseudomonas palustris
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap