Conserved Protein Domain Family

TIGR02259: benz_CoA_red_A 
benzoyl-CoA reductase, bcr type, subunit A
This model describes A, or gamma, subunit of the bcr type of benzoyl-CoA reductase, a 4-subunit enzyme. Many aromatic compounds are metabolized by way of benzoyl-CoA. This family shows strong sequence similarity to the 2-hydroxyglutaryl-CoA dehydratase alpha chain and to subunits of different types of benzoyl-CoA reductase (such as the bzd type).
PSSM-Id: 131312
Aligned: 2 rows
Threshold Bit Score: 835.443
Threshold Setting Gi: 499469586
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
WP_011156226 400 LRKLIQENYGEVTININPDSIYTGALGASEFA 431 Rhodopseudomonas palustris
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap