2A3V


Conserved Protein Domain Family
integrase_gron

?
TIGR02249: integrase_gron 
Click on image for an interactive view with Cn3D
integron integrase
Members of this family are integrases associated with integrons (and super-integrons), which are systems for incorporating and expressing cassettes of laterally transferred DNA. Incorporation occurs at an attI site. A super-integron, as in Vibrio sp., may include over 100 cassettes. This family belongs to the phage integrase family (pfam00589) that also includes recombinases XerC (TIGR02224) and XerD (TIGR02225), which are bacterial housekeeping proteins. Within this family of integron integrases, some are designated by class, e.g. IntI4, a class 4 integron integrase from Vibrio cholerae N16961. [DNA metabolism, DNA replication, recombination, and repair, Mobile and extrachromosomal element functions, Other]
Statistics
?
PSSM-Id: 131303
View PSSM: TIGR02249
Aligned: 9 rows
Threshold Bit Score: 508.086
Threshold Setting Gi: 12746334
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2A3V_A     5 FLLSVREFMQTRYYAKKTIEAYLHWITRYIHF--HN-KKHPSLMGDKEVEEFLTYLAVQGKVATKTQSLALNSLSFLYKE 81  Vibrio cholerae O1 ...
AAK73287   7 LLDQVREQIRLRHYSIRTEAVYLEWVKRYIRF--HK-YRHPQEMGGPEVEAFLSDLAVRRDVSASTQNQALSAILFLYKQ 83  Pseudomonas alcalig...
AAK07444   8 LLDQVRGRLRLRHYSLRTEQAYVGWIRRFILA--NG-KRHPAQMGQAEVEAFLTDLATRGQVSAGTQNQALAALLFLYRE 84  Xanthomonas campest...
P09999    16 VLDQLRERIRYLHYSLRTEQAYVHWVRAFIRF--HG-VRHPATLGSSEVEAFLSWLANERKVSVSTHRQALAALLFFYGK 92  Escherichia coli
AAS12359  20 ILNKLEEVITAKHYSKRTMEAYSYWISRFIRE--NK-NKNLKTLSDTEINAFVSRLAVKEKAAASSQNQALAALLFLYKN 96  Treponema denticola...
AAK02076   5 FLLSVKEHMLTRHYANKTIESYLFWIKRFIVF--HQ-LAHPSKLSEDDVIRFLSHLAIDEKVAVKTQALALNAISFLYRD 81  Vibrio parahaemolyt...
AAD55407   5 FLLSISEHMQTRFYAKKTIEAYLHWITRYIYF--HN-KKHPSLMGDKEVELFLTHLAVNGNVAAKTQSLALNSLSFLYKE 81  Vibrio mimicus
CAD73032 120 AIQEFRRSMRRAGLAIATERCYVRKLKAFMADrgLNcLADFDRIHACDVEAHLTDLAVDGNVSPSTQNQAFHSLLKFFEL 199 Rhodopirellula balt...
CAC35342   5 FLTMIKDHMYSKRYAKSTIEAYLFWIAAYIRF--NN-MQHPSSMGDTQVELYLNHLVNSQNVAQGTQAQALNALSFLYKE 81  Aliivibrio salmonicida
2A3V_A    82 ILKTPLSLEIRFQRSQLERKLPVVLTRDEIRRLLEIVD-PKHQLPIKLLYGSGLRLMECMRLRVQDIDFDYGAIRIWQGK 160 Vibrio cholerae O1 ...
AAK73287  84 VLQVELPWMDGVIRARRPQRLPVVLTREEVASVLAQLD-GTLWLIASLLYGSGMRLMEVLRLRVKDVEFARLEILIRDGK 162 Pseudomonas alcalig...
AAK07444  85 ILGLELPWMENLVRAKRPRRIPVVLSVEEVTRLLTMLE-GACRLMAGLLYGSGMRLLECLRLRIKDVDMVRCEIVVRDGK 163 Xanthomonas campest...
P09999    93 VLCTDLPWLQEIGRPRPSRRLPVVLTPDEVVRILGFLE-GEHRLFAQLLYGTGMRISEGLQLRVKDLDFDHGTIIVREGK 171 Escherichia coli
AAS12359  97 ILGLTIKTPENIVRAKKPKKLPAIMTREETAKIFSLLPeNDYGLLIRLLYGTGMRLMEALRLRIQDIDFGKNEITVHCGK 176 Treponema denticola...
AAK02076  82 FFKTPLSLDMRFQKSLTEKKLPVVLTRDEVRRFVQHID-PRYKLHIQLLYGSGLRIMECLRLRIQDIDYDYGAVRVWQGK 160 Vibrio parahaemolyt...
AAD55407  82 ILKMPLSLEIRFQRSQLERKLPVVLTRDEIRRLLDVVD-PKYQLPAKLLYGSGLRLMECIRLRIQDIDFDYGAIRIWQGK 160 Vibrio mimicus
CAD73032 200 VLKREMGKIE-AIRANKDSMAPTVMSPEEVGQVFEGLE-GVYLVIAKLLYGCGMRISETHRLRVKDIDFANKQIEIRQSK 277 Rhodopirellula balt...
CAC35342  82 IIKSPLSLSLDFVKSERPRKLPVVLTQTEVSALFKHCI-TKHYLACALLYGSGMRLMEVLRLRIQDIDFDYNCVRIWDGK 160 Aliivibrio salmonicida
2A3V_A   161 GGKNRTVTLAKELYPHLKEQIALAKRYYDRDlHQKNYGGVWLPTALKEKYPNAPYEFRWHYLFPSFQLSLDPESDVMRRH 240 Vibrio cholerae O1 ...
AAK73287 163 GQKDRVTMLPRKLAAPLELHLQRVRALHEQD-LREGYGRANLPHALARKYPNAAAEWGWQFVFPSVNRSEDPRSGGIFRH 241 Pseudomonas alcalig...
AAK07444 164 GGKDRRVPLPRSLRGELMQQRERALLLHAAD-LAEGAGQVFLPHALARKYPSADVEPGWQYLFPGARRSVDPRSGRVGLH 242 Xanthomonas campest...
P09999   172 GSKDRALMLPESLAPSLREQLSRARAWWLKD-QAEGRSGVALPDALERKYPRAGHSWPWFWVFAQHTHSTDPRSGVVRRH 250 Escherichia coli
AAS12359 177 GAKDRKTVLPVSLKFPLQKHMEKVRLIHEAD-CKEGFGSVPLPFALAKKYPNASKAWAWQWVFPQARRWRNKETGEQGRH 255 Treponema denticola...
AAK02076 161 GGKNRTVTLAKELHEPLKSQMNLARNYYFKDrHVPGYAGVYISEGLRRKYPNAELDFNWHFLFPSNKLSVDKETGQLRRH 240 Vibrio parahaemolyt...
AAD55407 161 GGKNRTVTLAKELYPHLKEQIALAKRYYDRDlHQKNYGGVWLPTALKEKYPNAPYEFRWHYLFPSFQLSLDPESDVMRRH 240 Vibrio mimicus
CAD73032 278 GNKSRLVPMPDDLIEPLRRFVKTRDALHEHD-LANGTASVYLPYALDRKYPSAHRELKWQYLFASHRLSRDPRTGRIHRH 356 Rhodopirellula balt...
CAC35342 161 GGKNRVVTLAGELIPQIRTQIQLVDNYLQLDlNNPLFCGVYMPHLLRKKYPNHNKQLGWQYLFPSYKLSIDPESKQLRRH 240 Aliivibrio salmonicida
2A3V_A   241 HMNETVLQKAVRRSAQEAGIEKTVTCHTLRHSFATHLLEVGADIRTVQEQLGHTDVKTTQIYTHVLDRGASGVLSPLSRL 320 Vibrio cholerae O1 ...
AAK73287 242 HLHEKTIQRAVRNAVRRVGLHKPATPHTLRHSFATHLLESGQDIRTVQELLGHADVKTTQIYTHVLNRGGLGVLSPLDRA 321 Pseudomonas alcalig...
AAK07444 243 HVSEEIRQRAVHAARRRAGIDKPATCHTLRHSFATHPLEAGHDIRTVQELLGHKDVATTQIYTHVLGRGASAVRSPLDGL 322 Xanthomonas campest...
P09999   251 HMYDQTFQRAFKRAVEQAGITKPATPHTLRHSFATALLRSGYDIRTVQDLLGHSDVSTTMIYTHVLKVGGAGVRSPLDAL 330 Escherichia coli
AAS12359 256 HIDPSVIQRTLHEAVLRSGIPKPIGCHTFRHSFATHLLEAGYDIRTIQELLGHSDVKTTMVYTHVLNRGGLGIQSPIDRM 335 Treponema denticola...
AAK02076 241 HINESAIQRAVKRSALDANIEKTVTCHTLRHSFATHLLESGADIRTVQEQLGHTDVKTTQIYTHVIERGAGGVLSPLSSL 320 Vibrio parahaemolyt...
AAD55407 241 HMNETVLQRTVRRSAQEAGIEKTVTCHTLRHSFATHLLEVGADIRTVQEQLGHTDVKTTQIYTHVLDRGASGVLSPLSRL 320 Vibrio mimicus
CAD73032 357 HLRATTFPTHLRRAVEQAGILKHVTSHTFRHCFATHLLWQGTDIRQIQQLLGHSDVKTTEIYTHVRNPHEAKVVSPLDRL 436 Rhodopirellula balt...
CAC35342 241 HIDEKQLQRAVKKAAFNAHINKHVTPHTLRHSFATHLLQSGADIRTVQTQLGHSDIRTTQIYTHVLQQGANGVISPFSRL 320 Aliivibrio salmonicida
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap