2AOQ,2AZO


Conserved Protein Domain Family
mutH_TIGR

?
TIGR02248: mutH_TIGR 
Click on image for an interactive view with Cn3D
DNA mismatch repair endonuclease MutH
This family consists exclusively of MutH, an endonuclease in some Proteobacteria that is activated by MutS1 and MutL for methylation-directed mismatch repair. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 131302
View PSSM: TIGR02248
Aligned: 6 rows
Threshold Bit Score: 386.501
Threshold Setting Gi: 46396404
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2AOQ_A   2 IPQTLEQLLSQAQSIAGLTFGELADELHIPVPIDLKRDKGWVGMLLERALGATA--GSKAEQDFSHLGVELKTLPINAEG 79  Haemophilus influenza...
Q8EH99   6 PPQNLSELLKRANMMAGISLAQIATHRGINVPNNLKRDKGWVGQLIEMELGATA--GSKPEQDFLHLGVELKTIPIDNHG 83  Shewanella oneidensis...
P44688   2 IPQTLEQLLSQAQSIAGLTFGELADELHIPVPIDLKRDKGWVGMLLERALGATA--GSKAEQDFSHLGVELKTLPINAEG 79  Haemophilus influenza...
Q89B33   2 CVFCEKKLFMHAIGLSGYSIREIVSSLDQPVSNSLVRNKGFVGKILELILGVNVlhGYKC-IDFPSLGIELKSIPINSSG 80  Buchnera aphidicola s...
P06722  10 PPETEEQLLAQAQQLSGYTLGELAALVGLVTPENLKRDKGWIGVLLEIWLGASA--GSKPEQDFAALGVELKTIPVDSLG 87  Escherichia coli K-12
2AZO_A  13 PPETEEQLLAQAQQLSGYTLGELAALVGLVTPENLKRDKGWIGVLLEIWLGASA--GSKPEQDFAALGVELKTIPVDSLG 90  Escherichia coli K-12
2AOQ_A  80 YPLETTFVSLAPLVQNS-GVKWENSHVRHKLSCVLWMPIEGSRHIPLRERHIGAPIFWKPTAEQERQLKQDWEELMDLIV 158 Haemophilus influenza...
Q8EH99  84 KPLETTYVCVAPLTNIE-GLTWQNSLVCHKLQRVLWVPVEGERHIPVGERRIGTPTLWEPDPQEQALLQQDWEEIMELIA 162 Shewanella oneidensis...
P44688  80 YPLETTFVSLAPLVQNS-GVKWENSHVRHKLSCVLWMPIEGSRHIPLRERHIGAPIFWKPTAEQERQLKQDWEELMDLIV 158 Haemophilus influenza...
Q89B33  81 YPLEPTFICNIPLKNNSlNITWNNSYFYRKIKKILWIPIIGNRVVSFLDKIVGEAFIWTMSSVQEKILKKDWEEFMDLII 160 Buchnera aphidicola s...
P06722  88 RPLETTFVCVAPLTGNS-GVTWETSHVRHKLKRVLWIPVEGERSIPLAQRRVGSPLLWSPNEEEDRQLREDWEELMDMIV 166 Escherichia coli K-12
2AZO_A  91 RPLETTFVCVAPLTGNS-GVTWETSHVRHKLKRVLWIPVEGERSIPLAQRRVGSPLLWSPNEEEDRQLREDWEELMDMIV 169 Escherichia coli K-12
2AOQ_A 159 LGKLDQITARIGEVMQLRPKGANSRAVTKGIGKNGEIIDTLPLGFYLRKEFTAQILNAFL 218 Haemophilus influenzae Rd KW20
Q8EH99 163 LGKVEKLTARHGEVLQLRPKAANSKAMTHSISEDGSLKMTNPRGFYLKTAFTAMILNKVF 222 Shewanella oneidensis MR-1
P44688 159 LGKLDQITARIGEVMQLRPKGANSRAVTKGIGKNGEIIDTLPLGFYLRKEFTAQILNAFL 218 Haemophilus influenzae Rd KW20
Q89B33 161 IGKVEYISSKHGQVLQVKKKCKNKHVCIKFINYNGCVKFTNPRAFYFRKSFTWSLLNLSK 220 Buchnera aphidicola str. Bp (Baizongia pi...
P06722 167 LGQVERITARHGEYLQIRPKAANAKALTEAIGARGERILTLPRGFYLKKNFTSALLARHF 226 Escherichia coli K-12
2AZO_A 170 LGQVERITARHGEYLQIRPKAANAKALTEAIGARGERILTLPRGFYLKKNFTSALLARHF 229 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap