3SHQ


Conserved Protein Domain Family
HAD_IIID1

?
TIGR02245: HAD_IIID1 
Click on image for an interactive view with Cn3D
HAD-superfamily subfamily IIID hydrolase, TIGR02245
This family of sequences appears to belong to the Haloacid Dehalogenase (HAD) superfamily of enzymes by virtue of the presence of three catalytic domains, in this case: LLVLD(ILV)D(YH)T, I(VMG)IWS, and (DN)(VC)K(PA)Lx{15-17}T(IL)(MH)(FV)DD(IL)(GRS)(RK)N. Since this family has no large "cap" domain between motifs 1 and 2 or between 2 and 3, it is formally a "class III" HAD.
Statistics
?
PSSM-Id: 131299
View PSSM: TIGR02245
Aligned: 6 rows
Threshold Bit Score: 306.359
Threshold Setting Gi: 28828788
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3SHQ_A   120 KVQRRVRDYK-IKELAPPREGKKLLVLDIDYTLFDHRSPAETGTELMRPYLHEFLTSAYEDYDIVIWSATSMRWIEEKMR 198 fruit fly
BAB83612 135 KLRRRIDQYK-INLRTPCRQGKKLLVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAEYDIMIWSATSMKWVELKMT 213 thale cress
BAB71628 117 KISRRVKEYK-VEILNPPREGKKLLVLDVDYTLFDHRSCAETGVELMRPYLHEFLTSAYEDYDIVIWSATNMKWIEAKMK 195 human
AAD34759 120 KVQRRVRDYK-IKELAPPREGKKLLVLDIDYTLFDHRSPAETGTELMRPYLHEFLTSAYEDYDIVIWSATSMRWIEEKMR 198 fruit fly
AAO51383 194 QLLAMIERSNdISLINDPRPNKKLLVLDLDHTILDFK--DQDVENMKRPHLEEFLVQSYQHYDIGIWSQTSWKWIEIKLT 271 Dictyostelium disco...
BAB86231 143 KLKRRASQYK-IKILNPCRKGKKLLVLDIDYTLFDHRSAAENPIELMRPYLHEFLSAAYSEYDIMIWSATSMKWVGMKMD 221 Japanese rice
3SHQ_A   199 LLGVASNDNYKVMFYLDSTAMISVHVPERG--------VVDVKPLGVIWA--LYKQYnSS-NTIMFDDIRRNFLMNPKSG 267 fruit fly
BAB83612 214 ELGVLNNPNYKVTALLDHLAMITVQSDTRG--------IFDCKPLGLIWA--LLPEFyNPgNTIMFDDLRRNFVMNPQNG 283 thale cress
BAB71628 196 ELGVSTNANYKITFMLDSAAMITVHTPRRG--------LIDVKPLGVIWG--KFSEFySKkNTIMFDDIGRNFLMNPQNG 265 human
AAD34759 199 LLGVASNDNYKVMFYLDSTAMISVHVPERG--------VVDVKPLGVIWA--LYKQYnSS-NTIMFDDIRRNFLMNPKSG 267 fruit fly
AAO51383 272 ELGLLTNPRFKICFVMDQTLMFKVTTYRTIngkertkiKHNVKALEVIWKhqHLGKFfSMkNTLHVDDLSKNFAMNPKNG 351 Dictyostelium disco...
BAB86231 222 QLGVLGNPNYKITALMDHLAMITVQSENLSek-----kTFDCKPLGVIWA--QFPEY-NEtNTIMFDDLRRNFVMNPQNG 293 Japanese rice
3SHQ_A   268 LKIRPFRQAHLNRGTDTELLKLSDYLRKIAhH-CPDFNSLNHRKWEHY 314 fruit fly
BAB83612 284 LTIKPFRKAHANRDTDQELVKLTQYLLTIA-E-LSDLSSLHHSRWESF 329 thale cress
BAB71628 266 LKIRPFMKAHLNRDKDKELLKLTQYLKEIA-K-LDDFLDLNHKYWERY 311 human
AAD34759 268 LKIRPFRQAHLNRGTDTELLKLSDYLRKIA-HhCPDFNSLNHRKWEHY 314 fruit fly
AAO51383 352 VHVPPFKIKDAKKYGDNVLFHLTKYLKSIS-N-EEDITLIDHKEWIRK 397 Dictyostelium discoideum
BAB86231 294 LVIKPYKRTHSNRGTDQELVKLTQYLLTIA-E-LEDLSKLDHSAWESF 339 Japanese rice
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap