Conserved Protein Domain Family
PHA_depoly_arom

?
TIGR02240: PHA_depoly_arom 
poly(3-hydroxyalkanoate) depolymerase
This family consists of the polyhydroxyalkanoic acid (PHA) depolymerase of Pseudomonas oleovorans, Pseudomonas putida BM01, and related species. This enzyme is part of polyester storage and mobilization system as in many bacteria. However, species containing this enzyme are unusual in their capacity to produce aromatic polyesters when grown on carbon sources such as benzoic acid or phenylacetic acid. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131294
View PSSM: TIGR02240
Aligned: 2 rows
Threshold Bit Score: 554.221
Threshold Setting Gi: 557586800
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P26495     4 PYIFRTVELDNQSIRTAVRPGKPHLTPLLIFNGIGANLELVFPFIEALDPDLEVIAFDVPGVGGSSTPRHPYRFPGLAKL 83  Pseudomonas oleovorans
ESR94512  56 PFVFRTIDLDGQTIRTAVRPGKEGSTPLLIFNGIGANLELVFPFVQALDPELEVIAFDVPGVGGSSTPSVPYRFPGLAKL 135 Pseudomonas aerugin...
P26495    84 TARMLDYLDYGQVNVIGVSWGGALAQQFAHDYPERCKKLVLAATAAGAVMVPGKPKVLWMMASPRRYVQPSHVIRIAPTI 163 Pseudomonas oleovorans
ESR94512 136 AARMLDYLDYGQVNAIGVSWGGALAQQFAHDYPERCKKLILAATSAGAVMVPGKPKVLMRMASPRRYIQPSYGVHIAPDI 215 Pseudomonas aerugin...
P26495   164 YGGGFRRDPELAMQHASKVRSGGKMGYYWQLFAGLGWTSIHWLHKIQQPTLVLAGDDDPLIPLINMRLLAWRIPNAQLHI 243 Pseudomonas oleovorans
ESR94512 216 YGGAFRRDPKLAMAHASKVRSSGKLGYYWQLFAGLGWTSIHWLHRIRQPTLVLAGDDDPIIPLINMRVLAWRIPNAELHV 295 Pseudomonas aerugin...
P26495   244 IDDGHLFLITRAEAVAPIIMKFLQQERQRAVMHPRP 279 Pseudomonas oleovorans
ESR94512 296 IDDGHLFLVTRAESVAPIIMKFLAEERRRAVMHPRP 331 Pseudomonas aeruginosa DHS01
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap