1V5W


Conserved Protein Domain Family
recomb_DMC1

?
TIGR02238: recomb_DMC1 
Click on image for an interactive view with Cn3D
meiotic recombinase Dmc1
This model describes DMC1, a subfamily of a larger family of DNA repair and recombination proteins. It is eukaryotic only and most closely related to eukaryotic RAD51. It also resembles archaeal RadA (TIGR02236) and RadB (TIGR02237) and bacterial RecA (TIGR02012). It has been characterized for human as a recombinase active only in meiosis.
Statistics
?
PSSM-Id: 131292
View PSSM: TIGR02238
Aligned: 7 rows
Threshold Bit Score: 574.803
Threshold Setting Gi: 6714639
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1V5W_A    27 IDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPG-FLTAFEYSEKRKMVFHIT 105 human
Q39009    31 IDKLIAQGINAGDVKKLQEAGIHTCNGLMMHTKKNLTGIKGLSEAKVDKICEAAEKIVNFG-YMTGSDALIKRKSVVKIT 109 thale cress
AAK43698  32 IEKLQDLGINAADINKLKGSGYCTILSLIQTTKKELCNVKGISEAKVDKILEVASKIENCSsFITANELVQKRSKVLKIT 111 malaria parasite P....
BAA89533  33 VDELQQHGINVQDIT--KSAAINTVSGVIMTTRRQLLKIKGMSEAKVEKIKEAAQKIHGSS-FATGVEIQDKRKRVLVIS 109 Coprinopsis cinerea
O42634    18 IEDLTAHGIGMTDIIKLKQAGVCTVQGVHMSTKRFLLKIKGFSEAKVDKLKEAASKMCPAN-FSTAMEISQNRKKVWSIS 96  Schizosaccharomyces...
P25453    19 VDELQNYGINASDLQKLKSGGIYTVNTVLSTTRRHLCKIKGLSEVKVEKIKEAAGKIIQVG-FIPATVQLDIRQRVYSLS 97  Saccharomyces cerev...
Q14565    24 IDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPG-FLTAFEYSEKRKMVFHIT 102 human
1V5W_A   106 TGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHD 185 human
Q39009   110 TGCQALDDLLGGGIETSAITEAFGEFRSGKTQLAHTLCVTTQLPTNMKGGNGKVAYIDTEGTFRPDRIVPIAERFGMDPG 189 thale cress
AAK43698 112 TGSTVFDQTLGGGIESMCITELFGENRCGKTQVCHTLAVTAQLPKSLNGGNGKVCYIDTEGTFRPEKVCKIAERYGLDGE 191 malaria parasite P....
BAA89533 110 TGSKLVDGILGGGVMSQSITEVYGEYRTGKTQLAHTMSVVAQLPPEYGGAAGKVAYIDTEGTFRPDRIRAIADRFGVDGT 189 Coprinopsis cinerea
O42634    97 TGSEALNGILGGGIQSMSITEVFGEFRCGKTQMSHTLCVTAQLPRDMGGAEGKVAFIDTEGTFRPDRIKAIAERFGVDAD 176 Schizosaccharomyces...
P25453    98 TGSKQLDSILGGGIMTMSITEVFGEFRCGKTQMSHTLCVTTQLPREMGGGEGKVAYIDTEGTFRPERIKQIAEGYELDPE 177 Saccharomyces cerev...
Q14565   103 TGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHD 182 human
1V5W_A   186 AVLDNVLYARAYTSEHQMELLDYVAAKFHEEagIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNV 265 human
Q39009   190 AVLDNIIYARAYTYEHQYNLLLGLAAKMSEE--PFRILIVDSIIALFRVDFTGRGELADRQQKLAQMLSRLIKIAEEFNV 267 thale cress
AAK43698 192 AVLDNILYARAFTHEHLYQLLAISAAKMCEE--PFALLVVDSIISLFRVDFSGRGELSERQQKLNKTMSILSKLSEQFNI 269 malaria parasite P....
BAA89533 190 MALENILYARAFNSEHQMELINECSARFAEDk-DFRLLIIDSIMALFRVDYSGRGELSERQQKLAQMLSKLTKLSEEFNI 268 Coprinopsis cinerea
O42634   177 QAMENIIVSRAYNSEQQMEYITKLGTIFAEDg-QYRLLIVDSIMALFRVDYSGRGELSERQQKLNIMLARLNHISEEFNV 255 Schizosaccharomyces...
P25453   178 SCLANVSYARALNSEHQMELVEQLGEELSSg--DYRLIVVDSIMANFRVDYCGRGELSERQQKLNQHLFKLNRLAEEFNV 255 Saccharomyces cerev...
Q14565   183 AVLDNVLYARAYTSEHQMELLDYVAAKFHEEagIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNV 262 human
1V5W_A   266 AVFVTNQMTADPGAtMTFQAD-PKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDA 341 human
Q39009   268 AVYMTNQVIADPGG-GMFISD-PKKPAGGHVLAHAATIRLLFRKGKGDTRVCKVYDAPNLAEAEASFQITQGGIADA 342 thale cress
AAK43698 270 AILITNQVMSDPGAtMTFIAN-PMKPVGGHVIGHASTIRLSLRKGKGDQRVCKVYDAPNLPEVECIFQLSDKGVIDA 345 malaria parasite P. fa...
BAA89533 269 AVLMTNQVQSDPGAtMTFVAGgALKPIGGHILSHASATRIFLRKGRAEERVAKLVDSPDRPESEASYKLDEGGWADV 345 Coprinopsis cinerea
O42634   256 AVFVTNQVQADPGAaMMFASN-DRKPVGGHVMAHASATRLLLRKGRGEERVAKLNDSPDMPEAECSYVITPGGIADV 331 Schizosaccharomyces po...
P25453   256 AVFLTNQVQSDPGAsALFASAdGRKPIGGHVLAHASATRILLRKGRGDERVAKLQDSPDMPEKECVYVIGEKGITDS 332 Saccharomyces cerevisi...
Q14565   263 AVFVTNQMTADPGAtMTFQAD-PKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDA 338 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap