1PZN,1T4G


Conserved Protein Domain Family
recomb_radA

?
TIGR02236: recomb_radA 
Click on image for an interactive view with Cn3D
DNA repair and recombination protein RadA
This family consists exclusively of archaeal RadA protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239), and archaeal RadB (TIGR02237). This protein is involved in DNA repair and recombination. The member from Pyrococcus horikoshii contains an intein. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 131290
View PSSM: TIGR02236
Aligned: 10 rows
Threshold Bit Score: 546.264
Threshold Setting Gi: 13878695
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1PZN_A  37 IEDLPGVGPATAEKLREAGYDTLEAIAVASPIELKEVAGISEGTALKIIQAARKAANLGTFXRADEYLKKRATIGRISTG 116 Pyrococcus furiosus
Q8PZN5   6 LEELPGVGPATAEKLKEAGFNTIEAVAVASPSELATTAEIGESTAAKIINAARQAADIGGFETGDLVLERRKLVGKLTTG 85  Methanosarcina mazei Go1
O29269  14 LEDIPGVGPETARKLREAGYSTIEAVAVASPSELANVGGITEGNAVKIIQAARKLANIGGFESGDKVLERRRSVKKITTG 93  Archaeoglobus fulgidu...
Q9V233  41 IEDLPGVGPATAEKLREAGFDTLEAIAVASPIELKEVAGISEGAALKIIQAARKAANLGTFMRADEYLKKRESIGRISTG 120 Pyrococcus abyssi GE5
O27436   4 LEDLPNVGAKTAQKLRDAGFGDMMRLATATAKELSVKAEIGEGVAEKVIEAARRAEKID-FETAFDVMERRKDVGRITTG 82  Methanothermobacter t...
Q8ZYR9  27 VEELEGIGRVTGAKLKERGYYTVRDIAFASVKELAEIIGN-EDRAQQIIEAARKMLGLHSFISALEVYERRKKIRRISTG 105 Pyrobaculum aerophilu...
Q9YFY1  11 ITDLPGVGPTTAQKLMEAGYTTLEAIAAATPQEVSQATGIPILTAQKIVDAAREALN-IDFKTAYDLKIESMNIKKITTG 89  Aeropyrum pernix
O73948   5 LTDLPGVGPSTAEKLVEAGYIDFMKIATATVGELTDIEGISEKAAAKMIMGARDLCDLG-FKSGIDLLKQRSTVWKLSTS 83  Methanococcus voltae
Q9HMM4   6 LEELPGVGPATAEKLRDNGFDAFQSLAVANSAELSNTADIGESTAADVIQAAREAADVGGFETGATVLERREQIGKLTWN 85  Halobacterium sp. NRC-1
1T4G_A   5 LTDLPGVGPSTAEKLVEAGYIDFMKIATATVGELTDIEGISEKAAAKMIMGARDLCDLG-FKSGIDLLKQRSTVWKLSTS 83  Methanococcus voltae
1PZN_A 117 SKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVXVQLPP---------EEGGLNG-SVIWIDTENTFRPERIREIA 186 Pyrococcus furiosus
Q8PZN5  86 CTEFDEMMGGGIETQAITELYGEFGSGKTQVAHQLAVNVQMDR---------EHGGLGG-SVIIIDTENTFRPERITQMV 155 Methanosarcina mazei Go1
O29269  94 SKDLDELLGGGVETQAITEFFGEFGSGKTQICHQLAVNVQLPE---------DEGGLEG-SVIIIDTENTFRPERIIQMA 163 Archaeoglobus fulgidu...
Q9V233 121 SKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQLPP---------EEGGLNG-SVIWIDTENTFRPERIREIA 190 Pyrococcus abyssi GE5
O27436  83 SKALDELIGGGIETQAITEVFGEFGSGKSQLSHELAVTVQLPE---------ERGGLDA-EAVFIDTENTFRPERIEQIA 152 Methanothermobacter t...
Q8ZYR9 106 VRSLDELLGGGIETRAVTEIVGEFGSGKTQLCHQLAVMVQLPE---------ERGGLGA-KAIYIDTENTFRPERIMQIA 175 Pyrobaculum aerophilu...
Q9YFY1  90 SRNLDELLGGGIETKTITELFGEFGSGKTQICHQLSVNVQLPE---------DKGGLEG-KAVYVDTEGTFRWERIEQMA 159 Aeropyrum pernix
O73948  84 SSELDSVLGGGLESQSVTEFAGVFGSGKTQIMHQSCVNLQNPEflfydeeavSKGEVAQpKAVYIDTEGTFRPERIMQMA 163 Methanococcus voltae
Q9HMM4  86 IPEVDDLLGGGVETQSITEVYGEFGAGKSQVTHQLAVNVQLPT---------EYGGLHG-RAVFIDSEDTFRPERIDDMV 155 Halobacterium sp. NRC-1
1T4G_A  84 SSELDSVLGGGLESQSVTEFAGVFGSGKTQIMHQSCVNLQNPEflfydeeavSKGEVAQpKAVYIDTEGTFRPERIMQMA 163 Methanococcus voltae
1PZN_A 187 Q--NRG-------LDPDE---------------VLKHIYVARAFNSNHQXLLVQQAEDKIKELLNtdrPVKLLIVDSLTS 242 Pyrococcus furiosus
Q8PZN5 156 NglSEKyg---meLNPEE---------------FLQNIHVARAYNSNHQILLVDSAVDLANELKEmgkPVRLLIVDSLMA 217 Methanosarcina mazei Go1
O29269 164 E--AKG-------LDGNE---------------VLKNIYVAQAYNSNHQMLLVDNAKELAEKLKKegrPVRLIIVDSLMS 219 Archaeoglobus fulgidu...
Q9V233 191 K--NRG-------LDPDE---------------VLKHIYVARAFNSNHQMLLVQQAEDKIKELLNtdkPVKLLIVDSLTS 246 Pyrococcus abyssi GE5
O27436 153 N--AFE-------LDLEE---------------VLNKIHIARAFNSSHQILMAEKVNELIQEGKN----IRLVIVDSLTA 204 Methanothermobacter t...
Q8ZYR9 176 K--ARG-------LDSDQ---------------ALHNIFYARAYSSDHQMILVEQAKSIIKQHN-----VALLVVDSVIA 226 Pyrobaculum aerophilu...
Q9YFY1 160 R--GVG-------LDPDE---------------VMKNIYWIRAINSHHQIAIVDKLFTMVKND-----NIKLVVVDSVTS 210 Aeropyrum pernix
O73948 164 E--HAG-------IDGQT---------------VLDNTFVARAYNSDMQMLFAEKIEDLIQEGNN----IKLVVIDSLTS 215 Methanococcus voltae
Q9HMM4 156 RglSDEtlqaameAHEIEgstddedtltelvdaFLDKIHVAKGFNSNHQMLLAEKAKEIASEHEDgdwPVRMLTVDSLTA 235 Halobacterium sp. NRC-1
1T4G_A 164 E--HAG-------IDGQT---------------VLDNTFVARAYNSDMQMLFAEKIEDLIQEGNN----IKLVVIDSLTS 215 Methanococcus voltae
1PZN_A 243 HFRSEYIGRGALAERQQKLAKHLADLHRLANLYDIAVFVTNQVQARPDAFFGDPTRPIGGHILAHSATLRVYLRKGKGGK 322 Pyrococcus furiosus
Q8PZN5 218 HFRAEYVGRGTLADRQQKLNKHMHGLLRFGDLFNACVVVTNQVMAKPDAFFGDPTRPIGGHIVGHTATFRLYLRKSKGEK 297 Methanosarcina mazei Go1
O29269 220 HFRAEYVGRGTLADRQQKLNRHLHDLMKFGELYNAAIVVTNQVMARPDVLFGDPTKPVGGHIVAHTATFRIYLKKGKDDL 299 Archaeoglobus fulgidu...
Q9V233 247 HFRSEYIGRGALAERQQKLAKHLADLHRLANLYEIAVFVTNQVQARPDAFFGDPTRPIGGHILAHSATLRVYLRKGKGGK 326 Pyrococcus abyssi GE5
O27436 205 HFRAEYVGREALATRQQKLNQHLHTLQNIANTYNAAVFVTNQVQARPDAFFGSPTKAIGGHVLGHAATYRIWLKKGLAGK 284 Methanothermobacter t...
Q8ZYR9 227 HFRSEFPGRENLAERQQKLNKHVADLLRLADAYDVAVVITNQVMAQPDVFFGNPLRPAGGNILAHGATYRLWLRKSKENI 306 Pyrobaculum aerophilu...
Q9YFY1 211 HFRAEFPGRENLAMRQQLLNRHLHQLMRLADIFNVAVVITNQVMARPDVFYGDPTQAVGGHVLGHAPGVRVYLKKSRGNK 290 Aeropyrum pernix
O73948 216 TFRNEYTGRGKLAERQQKLGRHMATLNKLADLFNCVVLVTNQVSAKPDAFFGMAEQAIGGHIVGHAATFRFFVRKGKGDK 295 Methanococcus voltae
Q9HMM4 236 HFRAEYVGRGELADRQQKLNKHLHDLEKVGNLYNAAVLVTNQVQSNPDAFFGDPTKPIGGNILGHKSTFRMYLRKSKNDK 315 Halobacterium sp. NRC-1
1T4G_A 216 TFRNEYTGRGKLAERQQKLGRHMATLNKLADLFNCVVLVTNQVSAKPDAFFGMAEQAIGGHIVGHAATFRFFVRKGKGDK 295 Methanococcus voltae
1PZN_A 323 RIARLIDAPHLPEGEAVFSITEKGIED 349 Pyrococcus furiosus
Q8PZN5 298 RIIRLVDSPSLPEGEAVVAVTTAGLTD 324 Methanosarcina mazei Go1
O29269 300 RIARLIDSPHLPEGEAIFRVTERGIED 326 Archaeoglobus fulgidus DSM 4304
Q9V233 327 RVARLIDAPHLPEGEAVFRITEKGIED 353 Pyrococcus abyssi GE5
O27436 285 RIARLVDSPHLPEGECVFKITTAGIVD 311 Methanothermobacter thermautotrophicus str. Delta H
Q8ZYR9 307 RIAKIFDSPYHPEGEVSFRITEEGLVD 333 Pyrobaculum aerophilum str. IM2
Q9YFY1 291 RIARVVDAPHLPEGETVFAITEWGIRD 317 Aeropyrum pernix
O73948 296 RVAKLYDSPHLPDAEAIFRITEKGIQD 322 Methanococcus voltae
Q9HMM4 316 RIVKLVDAPNLADGEAVMRVQDEGLKP 342 Halobacterium sp. NRC-1
1T4G_A 296 RVAKLYDSPHLPDAEAIFRITEKGIQD 322 Methanococcus voltae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap