Conserved Protein Domain Family
menA_cyano-plnt

?
TIGR02235: menA_cyano-plnt 
1,4-dihydroxy-2-naphthoate phytyltransferase
This family of phytyltransferases, found in plants and cyanobacteria, are involved in the biosythesis of phylloquinone (Vitamin K1). Phylloquinone is a critical component of photosystem I. The closely related MenA enzyme from bacteria transfers a prenyl group (which only differs in the saturation of the isoprenyl groups) in the biosynthesis of menaquinone. Activity towards both substrates in certain organisms should be considered a possibility. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]
Statistics
?
PSSM-Id: 131289
View PSSM: TIGR02235
Aligned: 5 rows
Threshold Bit Score: 384.864
Threshold Setting Gi: 35212143
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAP99247  20 LWKKAIKWPLYSVAIMPVILAAGWKQGAGEIIRLDQLVGFLIASILLLIWENLTNDLFDSTTGVDEFKLHSIVVLTGRRR 99  Prochlorococcus mar...
BAC09748  13 LWWAAIKLPLYSVAVMPIWLGTAVAIAKTGRGHWWPFGLFLTAAVLILAWLNLSNDVFDAETGIDRHKYHSVVNLTGKKQ 92  Thermosynechococcus...
P73962    18 LWLAAIKPPMYTVAVVPITVGSAVAYGLTGQWHGDVFTIFLLSAIAIIAWINLSNDVFDSDTGIDVRKAHSVVNLTGNRN 97  Synechocystis sp. P...
CAE18635   8 LWKQAIKWPLYSVAILPVFISGAYTLNSFKNVKIYNLIAFTIAAILILIWENLTNDLFDSETGIDEFKFHSIVNLVRSKT 87  Prochlorococcus mar...
BAC89519   8 PWLNSFNPLIYTASVIPILVGTAFAWWQGGVFDLQRFALTLAGLVFVHAWINLTNDVFDWDTGVDRNKLNSLVRTTGSRS 87  Gloeobacter violace...
AAP99247 100 LIRNLAYFILFLGLILILILASRSH-QAVFFLVIGSCALGYLYQGPPFRLGYQGLGEPLCWLAFGPLATAASLLVLSTnv 178 Prochlorococcus mar...
BAC09748  93 LIFWLSNLCLLLGLLGIAAISWLQQdGTVLGLVLLCCALGYSYQGPPFRLGYLGLGEPICFICFGPLAIAAAYYSQVQ-- 170 Thermosynechococcus...
P73962    98 LVFLISNFFLLAGVLGLMSMSWRAQdWTVLELIGVAIFLGYTYQGPPFRLGYLGLGELICLITFGPLAIAAAYYSQSQ-- 175 Synechocystis sp. P...
CAE18635  88 IVSITAYTSLLIGLVVIAIISISTS-INVMLLVGACCFLGYLYQGPPFRLGYQGLGEPLCWLAFGPFAYAAALIALNPsd 166 Prochlorococcus mar...
BAC89519  88 QVLWVGNIFLSIGYVCFWALQDWWL----LAFGSLGIFLGYAYQGPPFRLAYKGLGEWISSSCFGPIAVLTATRAQTG-- 161 Gloeobacter violace...
AAP99247 179 nHTNPIPWKAAISLGagpaVATTLVLFCANFHQVSEDAAHGKKTLLVRLGTGRAAAIVPWFILLCLGLEWIPIVYGQWPV 258 Prochlorococcus mar...
BAC09748 171 -TFSASIWPVAILNG----LTTTLILFCSHFHQVADDLAAGKRSPVVRLGTARSAQLVYGACGLFYGVLVASVLWGLLPW 245 Thermosynechococcus...
P73962   176 -SFSWNLLTPSVFVG----ISTAIILFCSHFHQVEDDLAAGKKSPIVRLGTKLGSQVLTLSVVSLYLITAIGVLCHQAPW 250 Synechocystis sp. P...
CAE18635 167 iYMISIPWKESLLLGsgssLATTLVLFCSHFHQIKEDKEHGKNSPLVLLGAKKGAKIIPWIVFIIYVFQLFLIINGFIPI 246 Prochlorococcus mar...
BAC89519 162 -SWELGALLAGIAVG----SWTATILYAHHFYQYEDDREFDKRTPVVRWGPELAAKRFWWVISPSYVVLLLAVIGGFLPW 236 Gloeobacter violace...
AAP99247 259 TALLGGIGIPPAIKLIRLLTDHHNHPKLISESKFLALRFQALNGIGLSIGLAL 311 Prochlorococcus marinus subsp. marinus str. CC...
BAC09748 246 PTLLALSSLPWAIYLCQRMAQFHSVPEQIKNSKFIAVQLHFWSSLLLGLGYLL 298 Thermosynechococcus elongatus BP-1
P73962   251 QTLLIIASLPWAVQLIRHVGQYHDQPEQVSNCKFIAVNLHFFSGMLMAAGYGW 303 Synechocystis sp. PCC 6803 substr. Kazusa
CAE18635 247 LCVLFLISFPQSLKLINLLKYSYNKPEAIKNCKFIAIKFQTLNGIGLIAGFII 299 Prochlorococcus marinus subsp. pastoris str. C...
BAC89519 237 TVLAALATIPLAVSLVSFVRENATNPAVVVGALPLAARFHLVSGALLTLGLLA 289 Gloeobacter violaceus PCC 7421
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap