2NZH,1GD7


Conserved Protein Domain Family
chap_CsaA

?
TIGR02222: chap_CsaA 
Click on image for an interactive view with Cn3D
export-related chaperone protein CsaA
This model describes Bacillus subtilis CsaA, an export-related chaperone that interacts with the Sec system, and related proteins from a number of other bacteria and archaea. The crystal structure is known for the homodimer from Thermus thermophilus. [Protein fate, Protein folding and stabilization, Protein fate, Protein and peptide secretion and trafficking]
Statistics
?
PSSM-Id: 131277
View PSSM: TIGR02222
Aligned: 8 rows
Threshold Bit Score: 174.912
Threshold Setting Gi: 12697606
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2NZH_A         7 IDDFEKLDIRTGTIVKAEEFPEARVPAIKLVIDFGTEIGIKQSSAQITKRYKPEGLINKQVIAVVNFPPRRIAGFKSEVL 86  Bacillus subtilis
CAE36912       6 WTDFAKVELRVGRIVQALPFPEARKPAYILHVDFGAEIGVKKSSAQVTHLYQPETLLGRLVVAVVNFPKKQIGPLQSECL 85  Bordetella para...
BAB21608       4 LEAFQILDLRVGRVLRAEPHEKARKPSYKLWVDLG-PLGVKQSSAQITELYRPEDLVGRLVVCAVNLGAKRVAGFLSEVL 82  Thermus thermop...
AAM23326       4 YEDFLKLDIRVGRIIEVEDFPKAKKPAYKLKIDFG-ELGVKTSSAQITKLYKKEDLYNRLVVCVVNFPPKKIADFVSEVL 82  Caldanaerobacte...
CAC12174      23 YGTFSKVDMRVGKIVDVQDFPEARKPAYRIRIYFGEDIGYRNSSAQITN-YTKEELIGMNIIAVVNFPPKQVANFISEVL 101 Thermoplasma ac...
WP_003109191   6 WQDFERVELRVGTILSAAPNPKARKPAYVLEVDLG-PLGLRTSSAQLTAHYQAEQLVGRQVLCVCNFAPKQIAGVRSEVL 84  Pseudomonas
P37584         4 IDDFEKLDIRTGTIVKAEEFPEARVPAIKLVIDFGTEIGIKQSSAQITKRYKPEGLINKQVIAVVNFPPRRIAGFKSEVL 83  Bacillus subtil...
1GD7_A         4 LEAFQILDLRVGRVLRAEPHEKARKPSYKLWVDLG-PLGVKQSSAQITELYRPEDLVGRLVVCAVNLGAKRVAGFLSEVL 82  Thermus thermop...
2NZH_A        87 VLGGIPGQGDVVLLQPDQPVPNGTKIG 113 Bacillus subtilis
CAE36912      86 VTGFHNAQGEVALCVPDRDVPLGTKLL 112 Bordetella parapertussis
BAB21608      83 VLGVPDEAGRVVLLAPDREVPLGGKVF 109 Thermus thermophilus
AAM23326      83 VLGVDDKEENVVLLQPEREVKVGNKVY 109 Caldanaerobacter subterraneus subsp. tengcongensis MB4
CAC12174     102 VLGAITDKG-VRLIQADSLSRPGDYIA 127 Thermoplasma acidophilum
WP_003109191  85 VTGVYDSEDKVVLAGFDKPLPNGARLA 111 Pseudomonas
P37584        84 VLGGIPGQGDVVLLQPDQPVPNGTKIG 110 Bacillus subtilis subsp. subtilis str. 168
1GD7_A        83 VLGVPDEAGRVVLLAPDREVPLGGKVF 109 Thermus thermophilus HB8
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap