Conserved Protein Domain Family
phage_NlpC_fam

?
TIGR02219: phage_NlpC_fam 
putative phage cell wall peptidase, NlpC/P60 family
Members of this family show sequence similarity to members of the NlpC/P60 family described by pfam00877 and by Anantharaman and Aravind (). The NlpC/P60 family includes a number of characterized bacterial cell wall hydrolases. Members of this related family are all found in prophage regions of bacterial genomes. [Mobile and extrachromosomal element functions, Prophage functions]
Statistics
?
PSSM-Id: 131274
View PSSM: TIGR02219
Aligned: 4 rows
Threshold Bit Score: 212.029
Threshold Setting Gi: 39648826
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAK24739      47 VIAQTRLWLGTPYRHQASTLGAGCDCLGLIRGVWRGLYGQEPEAPPPYRPDWAEIGVGELLIEAFGRWLVAIP-LSQAQP 125 Caulobacter cre...
CAE27347      10 LVAEARSWIGTSYRHQASVKGVGCDCLGLVRGVWRACLGEEPEAPPPYAPDWAEAGGDETLAAAALRHLVPVP-CDAFDK 88  Rhodopseudomona...
WP_004683307   7 VLAEAHRWIGTPYRHGASTLGVSCDCLGLVRGIWRALYGVEPENPGVYAPDWAEVSQGDPMLEAAVRYMVRRE-EHAPQP 85  Brucella
WP_010971294   8 VLAMAESWIGTPYRHQASLSGVGCDCLGLIRGIWRGLYGHEPELPPPYAPDWAERGGEDRLMAAAKRHFLTVPgMEEAQP 87  Agrobacterium f...
AAK24739     126 GDVLVFRMAPGAAAKHCAIKAAPDRIIHAYWGRACVESALGRWWRERCVAAFRFP 180 Caulobacter crescentus CB15
CAE27347      89 ADVLLFRWRDGCVAKHAAIASSATTMIHAHDGAAVCEVAITPWWRRRLAYAFTFP 143 Rhodopseudomonas palustris CGA009
WP_004683307  86 GDLLVFRWKPGFAAKHMGIMAREGRFIHAYQGHGVLASALVPQWRRRMAGIFLFP 140 Brucella
WP_010971294  88 GDLLLFRWRADAAAKHLGILAGPEHFIHAYEQAAVVRSALVPGWKRRIAGTFRFP 142 Agrobacterium fabrum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap