Conserved Protein Domain Family
spoVD_pbp

?
TIGR02214: spoVD_pbp 
stage V sporulation protein D
This model describes the spoVD subfamily of homologs of the cell division protein FtsI, a penicillin binding protein. This subfamily is restricted to Bacillus subtilis and related Gram-positive species with known or suspected endospore formation capability. In these species, the functional equivalent of FtsI is desginated PBP-2B, a paralog of spoVD. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131269
View PSSM: TIGR02214
Aligned: 4 rows
Threshold Bit Score: 1047.48
Threshold Setting Gi: 18145544
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAS42864      11 RLIFILISGILIFTIIDiRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRNGVELATNKSAPTVFVVPRQIEKPA 90  Bacillus cereus...
AAN87416      11 RSTHILISFTALVCILIlRLFWVQVVNGSFYAEKAEDVRMRELPVEAKRGTIFDRNMNSMAVSVSVDSVVANPAEVRKNK 90  Heliobacillus m...
BAB81586      16 RVLAFLLAIVILFLALSgRLLYISIFRSKDYKAMAEEQWTNEIQIDARRGRILDRNNRELAVTANVFRVDLDLITLRKYI 95  Clostridium per...
WP_010965429  16 IFIVFLILTCVIFLLCY-KLFNVMVARSSRYKKMAQEQWTSEVKISAKRGRILDRNGEELAISGNVYRVDLDLNTIKNSL 94  Clostridium ace...
AAS42864      91 ET--------AEKLAAVLGVEKDEIYKRITKKE---SIVRLDKggRKISHDKAKEVRG--LSLKGVYIAEDSIRYYPFGN 157 Bacillus cereus...
AAN87416      91 EPeqr---aiANELARVLEMDPEKVFQTITKAN---SGFVWVK--RKVEPDKIEQLRNstVKLNGISFIPESKRFYEKGK 162 Heliobacillus m...
BAB81586      96 DKkdtdnieiAKLLAEALEMDEEKVLSRIELTYpsgNPANSATliRRIEKEKADKVKE--LDINGVIVSEDTKRYYPNGD 173 Clostridium per...
WP_010965429  95 AEkkmkmdelADRLSSALDMDKKDVSKQLNKKFkdgRPMGSAIltRRIDKDKANKVLA--INVKGVMVSPDTKRYYPNSD 172 Clostridium ace...
AAS42864     158 FLSHVLGFAGSDNQGLMGLEKYYDKELNGDEGHVRFFADAKGQRMPNVGDDFKKPEAGLNLGLTIDARINRIMEREMNIA 237 Bacillus cereus...
AAN87416     163 LAAHILGFTDTDARGIEGLELIFDKELRGLPGKLVAEYDARNLELPQAQHAYVRPVDGHSLVLTIDETVQYIIERELDKL 242 Heliobacillus m...
BAB81586     174 FLSHTLGTTNADGEGLSGLELYYNEELMGIPGVRVSEVSGNSTSNPYSETSFTPPVDGKDMTLTIDENIQYFVEKVAEDA 253 Clostridium per...
WP_010965429 173 FLSQVIGHTNSDGDGLTGVELKYNKYLKGKPGVRKAEIDKNSANLPYTISEYSKPLDGRDVVLTIDKNMQYFAEKYAQEA 252 Clostridium ace...
AAS42864     238 ESTYNPDGMIAIAMNPKNGEILGMSSRPSFDPADfQSVSPEVYn-----------RNLPVWSTYEPGSTFKIITLAAALN 306 Bacillus cereus...
AAN87416     243 DRERKPKGATIIVMDVKTGRILGMSNRPTYDPNE-RDKYPDTAr-----------RNRAINDVYEPGSTFKIVTASAAME 310 Heliobacillus m...
BAB81586     254 LNKHNADSVSIAVMNPNNGEILGMVNKPGFNPNNpYEGSEAFKgkdesaklqnmwRNTIVSDAFEPGSIFKIITSIAAIE 333 Clostridium per...
WP_010965429 253 LVNNKAKAVSILIMNPKNGEILAMANKPDYDLNDpWDKSKSYDelq------kswRNRVVSDAFEPGSIFKVITSSAAMS 326 Clostridium ace...
AAS42864     307 ENLVDlEKDTFYDDGAAEVGGARLKCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKDRLFKYIRNFGFGQKTGIDLQG 386 Bacillus cereus...
AAN87416     311 EGAVK-ESDKFYDPGYATIGDRKVRCWKPDGHGSQTFPEVVQNSCNPGFIQIGMNLGVEKFYNYLLAFGFGSPTGISMNG 389 Heliobacillus m...
BAB81586     334 ENIAG-KDEVYYCDGSLNVAGKNIKCWKPGGHGVQNFNQTLENSCNVAFMEMGAKLGAEKLNEYIKLFGFGTQSGIDLPG 412 Clostridium per...
WP_010965429 327 LGIVH-ENDKFNCGGSITVAKKTIHCWKRTGHGEETFVDILKNSCNVGFAELGERLGAKNLNDYINKFGFGRKTGIDLPG 405 Clostridium ace...
AAS42864     387 EGSGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAAAVNGGTLYQPYIAKEFIDPKNn---QVVSKKTPVAKRKVIS 463 Bacillus cereus...
AAN87416     390 EAAGILVPKKTVKPIDLATMSIGQANAVTPIQLITAVSAVANGGKLMKPQLVEKILDSQG----AVIQTFEPEVVRQVVS 465 Heliobacillus m...
BAB81586     413 EATGIVKNVEDISAVDLATISFGQTNTMNGIQFMTALNAVANGGDLIQPHIMKELSHKDDngtkIIDEVFVPKIQENIVD 492 Clostridium per...
WP_010965429 406 EARGIIRPTNKIGPVDLATIAFGQSNTVSMVQYMQAFNSVANGGYLITPHVMREISHVENnr-qVVDKEYSDYNKKRILD 484 Clostridium ace...
AAS42864     464 KETSEKVRYALENVVAKGSGKGAFIDGYRVGGKTGTAQKVK--DGKYLENNYIVSFIGFAPADDPEIVVYVAVDNPKGVT 541 Bacillus cereus...
AAN87416     466 KETAQKLNLILETVVSKGTGTNAYIEGYRVGGKTGTAQKIKp-NGGYMEGEYVVSFVGIAPANDPAVACLVVVDAPQGVQ 544 Heliobacillus m...
BAB81586     493 EKSTMRVKEALESTVSNGSSKDAGIEGIKVAGKTGTAEKVDpeTGTYGAG-YIASFAGFAPYDNPQVSLIVIIDNPKNGE 571 Clostridium per...
WP_010965429 485 ESMTATLRGYLEKVVSEGGGKKAFIDGYHIGGKTGTAQKPNpnGGGYEHGKYIASFVGMAPASDPKITVMVSIDEPDPSN 564 Clostridium ace...
AAS42864     542 QFGGVVAAPIVGNILRDALPVMGVKPRKEQVER-EYKWgdtPTVEVPNLIGMKKKDLQTQLVDLKLDISGD--GEKVIKQ 618 Bacillus cereus...
AAN87416     545 QFGGLVAAPVFKSVMTDVLRHLGIPPQMNTGEApAAATnqvEAVAVPQVTGIGVDDAEDRLLHVGLGVATEgfGTRVVNQ 624 Heliobacillus m...
BAB81586     572 HFGGIVAAPFAGELFNNIFNYISLN--EGQLDAkD------ESVIIPDLRGDKVTSAEKTLNELGINCVIEgdGTFVTSV 643 Clostridium per...
WP_010965429 565 YYAGQISAPVGQKVFNDIFNYLGIKPDTSSSDAaKSML---KDVVIPNIRGMKKEDAIKTLKNLNIDADVDgnGEYVSNT 641 Clostridium ace...
AAS42864     619 SPEAGAKVKEGSKIRIYFGN 638 Bacillus cereus ATCC 10987
AAN87416     625 LPQPGEKVTPQTTVVLYLAE 644 Heliobacillus mobilis
BAB81586     644 TPIPGYKVKKGDSITLYAGS 663 Clostridium perfringens str. 13
WP_010965429 642 TPIPGITVKEGTKVVLYTGD 661 Clostridium acetobutylicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap