Conserved Protein Domain Family
lolE_release

?
TIGR02213: lolE_release 
lipoprotein releasing system, transmembrane protein LolE
This protein is part of an unusual ABC transporter complex that releases lipoproteins from the periplasmic side of the bacterial inner membrane, rather than transport any substrate across the inner membrane. In some species, the permease-like transmembrane protein is represented by two paralogs, LolC and LolE, both in the LolCDE complex. This family consists of LolE, as found in E. coli and related species. [Protein fate, Protein and peptide secretion and trafficking]
Statistics
?
PSSM-Id: 131268
View PSSM: TIGR02213
Aligned: 3 rows
Threshold Bit Score: 683.106
Threshold Setting Gi: 27361562
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CMCP6:VV1_2082   4 SLALLIGRRFSQAKQRNKMVSFISLSSTIGIAVGVAVIIIGLSAMNGFERELQSRVLSVIPHAELEGVR----APVENWQ 79  Vibrio vulnif...
P75958           4 PLSLLIGLRFSRGRRRGGMVSLISVISTIGIALGVAVLIVGLSAMNGFERELNNRILAVVPHGEIEAVD----QPWTNWQ 79  Escherichia c...
P44250           2 NTPFFISWRYQRGKQKNPLVALIAKFSAIGIALGVAVLIVGLSAMNGFERELNQRILAVVPHAEILSAPnatePTIHHWQ 81  Haemophilus i...
CMCP6:VV1_2082  80 SVMTQAVANPKVVAAAPYVKFTGLVERGNKLKAVEVRGVEPDFEQAVSTMSQFIDQQAWSQFLPGQNQVIVGRGVANELG 159 Vibrio vulnif...
P75958          80 EALDHVQKVPGIAAAAPYINFTGLVESGANLRAIQVKGVNPQQEQRLSALPSFVQGDAWRNFKAGEQQIIIGKGVADALK 159 Escherichia c...
P44250          82 NLEKRLQQNPQIKGISPFVSFTALVENGSKLKVVQVKGVEKQAEDKVSSIGNFVQEQGWNKFEK-EGGLVLGSGIAKELD 160 Haemophilus i...
CMCP6:VV1_2082 160 VDVGDYVTLLIPQTGESTKVQAPKRVRVKVTGMLTLNGQIDHNLVLLPMADAQQYNHLG-EGVTGIALKTNDVLNAQAIV 238 Vibrio vulnif...
P75958         160 VKQGDWVSIMIPNSNPEHKLMQPKRVRLHVAGILQLSGQLDHSFAMIPLADAQQYLDMG-SSVSGIALKMTDVFNANKLV 238 Escherichia c...
P44250         161 VKVGDWITLLISQQNGDEQFAQPTREPVQVTSILRLDGQLDYSYALLPLAQAQTFLTYQpDQITGVELKLDDPFSARNLD 240 Haemophilus i...
CMCP6:VV1_2082 239 REVGRQIDVYVYLRSWQQQFGFLYRDIQLVRTIMYLVMVLVIGVACFNIVSTLMMAVKDRASEIAILRTMGAGDGLIKRI 318 Vibrio vulnif...
P75958         239 RDAGEVTNSYVYIKSWIGTYGYMYRDIQMIRAIMYLAMVLVIGVACFNIVSTLVMAVKDKSGDIAVLRTLGAKDGLIRAI 318 Escherichia c...
P44250         241 LSMLNDYPQMLYMQNWISKFGYMYRDIQLIRTVMYIAMVLVIGVACFNIVSTLIMAVKDKQGDIAIMRTLGANNAFIKRI 320 Haemophilus i...
CMCP6:VV1_2082 319 FVWQGVFSGVLGSVLGSVVGVLVALNLTTLIKGLERVIGHQFLSGDIYFVDFLPSQLRVDDVLLVSGTAIVLSIVATWYP 398 Vibrio vulnif...
P75958         319 FVWYGLLAGLFGSLCGVIIGVVVSLQLTPIIEWIEKLIGHQFLSSDIYFIDFLPSELHWLDVFYVLVTALLLSLLASWYP 398 Escherichia c...
P44250         321 FIWYGLQAGMKGCLIGIVLGIILALNLTTFIQGIEWVIGKKLLSGDVYFVDFLPSELHWLDVLMVLVAALALSLMASLYP 400 Haemophilus i...
CMCP6:VV1_2082 399 AARAAKLKPAAVLSSK 414 Vibrio vulnificus CMCP6
P75958         399 ARRASNIDPARVLSGQ 414 Escherichia coli K-12
P44250         401 ASRAAKLQPAQVLSSH 416 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap