Conserved Protein Domain Family
LolD_lipo_ex

?
TIGR02211: LolD_lipo_ex 
lipoprotein releasing system, ATP-binding protein
This model represents LolD, a member of the ABC transporter family (pfam00005). LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on whether the residue immediately following the new, modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. The top scoring proteins excluded by this model include homologs from the archaeal genus Methanosarcina. [Protein fate, Protein and peptide secretion and trafficking]
Statistics
?
PSSM-Id: 131266
View PSSM: TIGR02211
Aligned: 9 rows
Threshold Bit Score: 356.662
Threshold Setting Gi: 25166056
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q44613     6 ILQCINLTKSFYRKKEEIRTLNKISLKIRKGDITFITGKSGSGKSTLLHLLGGLDKPTSGSILFDGVSLHSMSSNEIAKL 85  Buchnera aphidicola...
P57383     5 IIKCINLNKSYKDGDFTYTILKNISFQLNKGDIAGIIGKSGSGKTTFLHLLAGLENPTSGDILFNGRLFSSMSSNKMSKF 84  Buchnera aphidicola...
BAC24247   6 LLKCKNVTKTYKTNKKKIIILNNINLSIYNSETISIIGDSGSGKSTLLYLLSGLDNPTTGKITFKGKEINKLSSSDRSYL 85  Wigglesworthia glos...
AAQ60631   4 VLSCRSLGKRYQEGKLALDVLSGVDLEVGKGEHLAIVGASGSGKSTLLHLLGGLDTPTAGTVEVLGRDLSKLSETERGKL 83  Chromobacterium vio...
P57032    14 VIRAERLGKTYSEGKLLTQVFDGLDLQVMRGETVAIVGASGAGKSTLLHLLGGLDVPTAGEVYVAGQRMSALSDGDRGRL 93  Xylella fastidiosa ...
P57031     5 ILKCEGVGKRYRDGGLDVRVLHGLDLEIHAGESTGIIGSSGSGKSTLLHILGGLDMPSEGRVLLMGEDLRTLNQRRLGDL 84  Neisseria meningiti...
P45247     5 LLKCENINKFYQEGENQTQVLKGVSFSMEPAELVAIVGSSGSGKSTLLHTLGGLDQPSSGEVFINGQSLQKASANELAAL 84  Haemophilus influen...
Q87R20     4 LLECRDIRKVYREGSLDTEVLKGVSFDIDKGELVSIVGSSGSGKSTLLHILGALDDATQGEVDFLGQNLSALSSNKQAAL 83  Vibrio parahaemolyt...
P75957     5 LLQCDNLCKRYQEGSVQTDVLHNVSFSVGEGEMMAIVGSSGSGKSTLLHLLGGLDTPTSGDVIFNGQPMSKLSSAAKAEL 84  Escherichia coli K-12
Q44613    86 RNLKLGFIFQFHHLLLDFNVLENIAIPSLISKKSIQESKEKSYEILKKVHLEKKINKYPSELSGGERQRVAIARALVNQP 165 Buchnera aphidicola...
P57383    85 RNIELGFIYQFHHLMLDFNILENVSMPLLISNKSKKDSEEIAYNMLKKFNLEDKIKKYPSELSGGERQRVAVARAFINKP 164 Buchnera aphidicola...
BAC24247  86 RNKNFGFIYQFHHLLTDFSVLENVAMPALIGNFSVKHAKNLAYKLLLEVGLKNRINHKPSEISGGERQRAAIARSLINNP 165 Wigglesworthia glos...
AAQ60631  84 RNESMGFVYQFHHLLPEFTALENVMMPLLIRRMDKGEAARRAAEMLERVGLGKRLEHKPGELSGGERQRAAIARALVTQP 163 Chromobacterium vio...
P57032    94 RNKTLGFIYQFHHLLPEFTALENVMMPVLLSGQSVCSGQMRAQMLLEAVELGHRLNYKPSELSGGERQRAAVARALANSP 173 Xylella fastidiosa ...
P57031    85 RNRHLGFVYQFHHLLPEFSALENVMMPLLIGKKSREEAAEAAMAMLEKVGLKHRSTHRAGELSGGERQRAAIARALVTQP 164 Neisseria meningiti...
P45247    85 RNRYLGFVYQFHHLMADFTALENVMMPMLIGHQNKTEAKDRAEKMLSAVGLSHRITHRPSALSGGERQRVAIARALVNNP 164 Haemophilus influen...
Q87R20    84 RNKHLGFVYQFHHLLADFTALENVAMPLLIGGIKVTEAKQAAKALLEKVGLSHRMDHRPSELSGGERQRVAIARALVNKP 163 Vibrio parahaemolyt...
P75957    85 RNQKLGFIYQFHHLLPDFTALENVAMPLLIGKKKPAEINSRALEMLKAVGLDHRANHRPSELSGGERQRVAIARALVNNP 164 Escherichia coli K-12
Q44613   166 SLVIADEPTSHLDKNNAKIIFDLIFELNSNLNTSFLIVSHDLRFIKKAPILLEMKNGQLFN 226 Buchnera aphidicola str. Sg (Schizaphi...
P57383   165 SLIIADEPTGNLDEDNTNIIFNLITELNSDYNTSFIIATHDPTLIKKIPVLFKIENNQIFN 225 Buchnera aphidicola str. APS (Acyrthos...
BAC24247 166 KIVFADEPTGNLDNTSSKKFFCLLKKVNVEKKTAFLVVTHNIKLAKKLDKTLEIKNGKLYK 226 Wigglesworthia glossinidia endosymbion...
AAQ60631 164 ACLLADEPTGNLDAHTASQVFELMLELNRTLGTSLIIVTHDLELAGRTQRVLRLNEGRLAV 224 Chromobacterium violaceum ATCC 12472
P57032   174 DCVLGDEPTGNLDNRTASTVFELMLELNRAQRTSLVLVTHDRGLARCLDRVLELYQGGLRE 234 Xylella fastidiosa 9a5c
P57031   165 KCLLADEPTGNLDRANARNVLDMMLELKTELGTGLVVVTHDDELAGRFERVMVMKDGSLHP 225 Neisseria meningitidis MC58
P45247   165 SLVLADEPTGNLDHKTTESIFELIQQLNQEQNIAFLLVTHDMGLAEKLSRRLVMQDGLLKE 225 Haemophilus influenzae Rd KW20
Q87R20   164 DLVLADEPTGNLDHNTALAIYDLMRELNKESNIAFLVVTHDNELAAKMDRQMHMQDGLLVD 224 Vibrio parahaemolyticus RIMD 2210633
P75957   165 RLVLADEPTGNLDARNADSIFQLLGELNRLQGTAFLVVTHDLQLAKRMSRQLEMRDGRLTA 225 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap