Conserved Protein Domain Family
ftsL_broad

?
TIGR02209: ftsL_broad 
cell division protein FtsL
This model represents FtsL, both forms similar to that in E. coli and similar to that in B. subtilis. FtsL is one of the later proteins active in cell division septum formation. FtsL is small, low in complexity, and highly divergent. The scope of this model is broader than that of the pfam04999.3 for FtsL, as this one includes FtsL from Bacillus subtilis and related species. [Cellular processes, Cell division]
Statistics
?
PSSM-Id: 131264
View PSSM: TIGR02209
Aligned: 20 rows
Threshold Bit Score: 57.6603
Threshold Setting Gi: 33322319
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAD84895              1 MIKLNIFLFMVLVICGLGIVTARYESRKLFMEQEEAQQLTEQLETEWNQLRLEQTTLAMPARVEKIARKELgmTMPPPAA 80  Nitrosom...
CAD83656             19 YGKVRLLLLLFIMVSAMLVIIVTHQTRCMIMEQDKFLLEVNMLDHEWSNLILEKKKLSNHIRVESIAIQKL--QMRYTDP 96  Candidat...
BAC24359             18 FSKLSIFITILILITSVLTIYITYKTRYFINEREKIFLENDFLEHEWNNLILEKYVLGNNNRIGSLAKKNF--NMNYIDY 95  Wigglesw...
P45058               22 SNKLVVLLLIGILVSAMGTIWITHKTRQLISENGMLILQRQALENEYRNLQVQEATEGDSTRVESIAISTL--KMKVVSS 99  Haemophi...
CAE34568              1 MGRTSLIVAALLMLSAISLVTSRYQSRQLFIELGRSQAEARDLDTNWRRLQLERAELARNARIDRAARDDL--KMIPIVP 78  Bordetel...
CAD16558              1 MNRLNMFLLTALVLCALSLVNAQHQARQLFVELDRAQAEEKQLNIDWSRLQYEQSSLGKSARIAEIARTQL--KMAPAQA 78  Ralstoni...
lhbprmlnih:CBU_0117  25 QGVVIVALVIALLCSAFGVVYFKDLNRRLFIQYQTLQREKAEELIQWGKLLLEQTTWSTQSRVQRIAEQQL--GMQLPSA 102 Coxiella...
AAO57864             12 GSFIMLLLFIAVLVSAIGVSYSAHWNRQLLNSLYSEMSVRDKAQAEWGRLILEQSTWTAHSRIETLATEQL--KMRIPSA 89  Pseudomo...
EFK03900             35 FGKLPLCLFICIILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEKL--QMQHVDP 112 Escheric...
WP_002220363          1 MNKLNFLLLLAVCVSAFSVVMQQNQYRLNFTALDKAKKQEIALEQDYAQMRLQQARLANHEAIRAAAEKQ---NLHPPVS 77  Neisseria
CAD84895             81 GNILAIH 87  Nitrosomonas europaea ATCC 19718
CAD83656             97 ILDNMYK 103 Candidatus Blochmannia floridanus
BAC24359             96 SKENIII 102 Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis
P45058              100 EQEVEIR 106 Haemophilus influenzae Rd KW20
CAE34568             79 DRTLYMN 85  Bordetella bronchiseptica RB50
CAD16558             79 GRTQYLQ 85  Ralstonia solanacearum GMI1000
lhbprmlnih:CBU_0117 103 KEVILVN 109 Coxiella burnetii RSA 493
AAO57864             90 AEVRMVA 96  Pseudomonas syringae pv. tomato str. DC3000
EFK03900            113 SQENIVv 119 Escherichia coli MS 182-1
WP_002220363         78 GNTFMVE 84  Neisseria
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap