Conserved Protein Domain Family
intg_mem_TP0381

?
TIGR02206: intg_mem_TP0381 
conserved hypothetical integral membrane protein TIGR02206
This model represents a family of hydrophobic proteins with seven predicted transmembrane alpha helices. Members are found in Bacillus subtilis (ywaF), TP0381 from Treponema pallidum (TP0381), Streptococcus pyogenes, Rhodococcus erythropolis, etc.
Statistics
?
PSSM-Id: 131261
View PSSM: TIGR02206
Aligned: 9 rows
Threshold Bit Score: 164.017
Threshold Setting Gi: 19748576
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P25149               12 DPFHLFSTEHVVTLAIISLLAILLFLFQDEVKQPRASRFLRslfVFLLLGSQIGYQIWMVATDRWSVRTSLPLQLSDLSV 91  Bacillus...
jcvi:BA_0800         11 KPFIPYSRQHAIILFIMLVGIVFLYQYQDVLRQNEWNITVRyaiAILFIGSEIGLHMWEWKAGIFELATSLPFELCTISL 90  Bacillus...
AAL95192              3 DKFVLFSNQHFITMGIGFFSCILLVFLGFFTEKKVAFAKII---AIIVLGVKIAELSFRYYYYGETVAQLLPLHLCPIVI 79  Fusobact...
AAR05203              2 SPFNLLSPSHIIVCIMCFVAIVYIPKYFKNSTDTAKLLLSY---SIIFLMLINQGMDFYREGYLDEWKLGLPLHLCDFAS 78  uncultur...
BAB80534             19 YTFPLFSSLHFKIILCVVITIFIAIIFKEKIKKWKYRRAFEittALILISTQIFLAIWYSRFPNFYLKESLPLYPCRIAI 98  Clostrid...
O83396               10 GLFVRFGALHFAIASVAVLLSALFVLLPFALPRLLAHKNLAr-aGVAILFLRLGLMLCGTLLDGRSWRNELPFHLCPAAL 88  Treponem...
AAL98013              6 IDPIGLPHTSLIFYLSSLLIALLLVFLTFQAYRLKSYRYFF---LFLQLSQVIGLYTWYVLRG-FPLDEALPLYHCRIAM 81  Streptoc...
goettingen:PBD2.092  21 PEFSAYGLSHWAVIALFVVGSVFLIFAGRRQTEVQARHLSR---VLGGILAVIYGSAVLYSLSSPTLGGSVPLQLTDLAT 97  Rhodococ...
CAF19789              8 GAMPQYGFEHISMLITAVVLAILVVPIARRFNFAPAFGWVL------LI-ATLLSNLWNFMPGYYTLDQSWPFHFSDALR 80  Coryneba...
P25149               92 YLSAIMLVTKSR-KLFVFLFFVGIGSSIQALATPDLgMFSFPHIRYILFFISHGSVFLSCLLMAVIGTYRMGQRSLWVTV 170 Bacillus...
jcvi:BA_0800         91 LLASIMIVTKSY-RIYEIVFFTGIIGASQAILTPNL-QYAFPHFRFIEYFIAHILLIWAPLFMTWVEGYRPTVQSIKRTM 168 Bacillus...
AAL95192             80 ILSIFMMFFHSE-ILFQPVYFWSIG-AFFAILMPDIr-DGMSNFASQSFFITHFFILFSTVYAFVHFRFRPTKSGFIYSF 156 Fusobact...
AAR05203             79 LAGALYLITKKR-EFFLFAFFFGIAGGTMSILTPDV-IYGFPHVPYIQNEIGHLLIILSVSYGIIIDNQRPYLKDCHRVL 156 uncultur...
BAB80534             99 IMAAIGLIWKKNdFAKSIAYFWGTIGAIGALMIPITnSYIFPHITYYTFFIGHYFLLIASLYLILIEEFKVKSKNVKQAL 178 Clostrid...
O83396               89 ISGSLYFITRRP-IFFNLLYFWHFG-SFVAVLYPDLt-RAHTILYAYLFMLTHCLEPAMVVFSLLHLRERISKRGLQCAV 165 Treponem...
AAL98013             82 LA--IFFLPDRN-KFKQLFMVLGIGGTFLALLSPDLyPFRLWHVANVSFYLGHYALLVNGLIYLLRFYDASQLRLLSVVR 158 Streptoc...
goettingen:PBD2.092  98 VSAIYALWSHRH-WPFALTYYWGLVLSTQALISPALaGPDFPGYEFLVFWAIHLFVVWAAIYLTWGRRMRPTWRSYRLAV 176 Rhodococ...
CAF19789             81 IIAAIALINRAR-WAVSVTILWGTTINLMSLLTPDVqYLQVPWLEFLMYWFMHISVFLAAIILIFAFGEKPGLSGVVMSV 159 Coryneba...
P25149              171 LLVNVYGVCIFLIDRWLG--ANYMYLTKKPGGSSLLDVLGPWPWYIVS---AEAITIASFFILYWLYRIFK 236 Bacillus subtilis...
jcvi:BA_0800        169 IFLNILIPIVSFVNYKTG--GNYMFLAHKPETASLLDMLGPHPYYIIS---LELAALIGCFILYMPFAKRE 234 Bacillus anthraci...
AAL95192            157 LMLVILAFIMYFINNRLG--TNYLYVNHPPVTKSLVDFMGPWPYYIFS---LAGIDIAISFFMYLPFRRNK 222 Fusobacterium nuc...
AAR05203            157 IFASFLLAIMYLVNYLLGppANYWYLAEKPIGDNITSFMRPEPFHVID---LYALAVILVYLMYLPYYLKD 224 uncultured marine...
BAB80534            179 IFSFIFAICAFIANYLFD--ANYAFLN-PPNGYEILNIINVESNIITTsifAYFIFVLGIFIMYLPFNMSD 246 Clostridium perfr...
O83396              166 LGFLLLAANALFWNRRLG--ANYLFISKYP--LEILRVIRPFFVYQLL---FVSALCLLMLVLYLPFRPSQ 229 Treponema pallidu...
AAL98013            159 YLATVNFLLLLVSLATKG---NYGFVMDIPVIHTRHLLLN--FVIVTS---GLTFMVKITEYFYLKFGEAQ 221 Streptococcus pyo...
goettingen:PBD2.092 177 LVTLTWAIVTFIFNRVAD--TNYGFLNAKPSTASLLDLMGPWPVYLFS---GMTIVFVIWALMTWPWERDG 242 Rhodococcus eryth...
CAF19789            160 AVAISWGIMCLMVNAFLG--TNYGYLSTEPESASILDLLGGWPFYIVA---EVLLLCAVWALWSYLIDKLP 225 Corynebacterium g...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap