Conserved Protein Domain Family
MsbA_rel

?
TIGR02204: MsbA_rel 
ABC transporter, permease/ATP-binding protein
This protein is related to a Proteobacterial ATP transporter that exports lipid A and to eukaryotic P-glycoproteins.
Statistics
?
PSSM-Id: 131259
View PSSM: TIGR02204
Aligned: 8 rows
Threshold Bit Score: 856.692
Threshold Setting Gi: 15075799
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAC47354                 12 RSIRPLATVLPYLSRYRGLAIGAAVSLTIAAATTLTLPLAVRRMIDHGFSNSDSGFINTYFSMLMVLAVVLALASAARYY 91  Sino...
BAC46773                 49 AKLRPLLALAPYVARYRGRAALAFVALTIAALTTLLVPVAVRRMIDFGLTPEGIELINSYFSVMIAVVAVLALASAARYY 128 Brad...
AAK25236                 36 KDIRPLAHLLPFVIAHKGDGLAAGFFLLFSTAATLGLTYAFKNVIDHGFSKGQDAAINSAFVGLGAVALVLALATALRFF 115 Caul...
tigr:EBAC080-L028H02.67  18 KRIGALAALWPFVRPYRVMMGFAIVALVATATVSLVLPLAVRKVVDN-FNADESNLLDQYFAMAIVVVALLAFGTGMRYA 96  uncu...
AAO29791                 49 QRLNHLRILWPFMRRHLALFSGWLIALAVSSAATLTLPSAFKQMIDHGFSSE--GQINRSFALLLLVAVILAVGTAARLF 126 Xyle...
CMCP6:VV2_0179            7 KNLGILLKLSTFVSPYRWRVAAALVALVATASLTLSVGYGVRMLIDQGFAQQSLHELTNAIQFIVGVTLCIAIGTFFRFY 86  Vibr...
AAN56650                 11 SQRAVLPWIWQFLKPYRPRVVAAIVFLLIGSLAWLSLGQGVRLMVDEGFIKDNAQRLNEIILFVLVITAVSGTAVFCRFY 90  Shew...
WP_003112499              8 RQRIALRLAWRFMAPYRWRMLGALVALLFTAAITLSLGQGIRLLVDQGFLTASPELLNRYILLFFVLVLGLAVGTFVRFY 87  Pseu...
CAC47354                 92 FVISLGERIVADLRRDVFARVMQLSASFFDVNQSGEIVSRLTADATQIKSAVGATASVALRNLILCLGAMGMMVYTSPKL 171 Sino...
BAC46773                129 LVMTIGERIVADLRRDVFAHLLSLSPAFFDSARSGELISRLTADTTQLKSAVGASVSIALRNLMMFFGAVAMMVITSPKL 208 Brad...
AAK25236                116 FITRLGERVVADLRRKLYGHTLSLDQPYFLKTRTGEVLSRLTTDVALVEQLVGASISIALRNILNLIGGLTAMAVVSPKL 195 Caul...
tigr:EBAC080-L028H02.67  97 LVTRLGERVVTDIRKAVFGRVINMSPAFYDNILTGEVLSRITTDTTLILSVIGASVSIALRNMLIFAGGLTMLLLTSVKL 176 uncu...
AAO29791                127 SVSLLGEKIITDLRSQLYAHLIGLDASFHDRNRSNELVSRLATDSELLRSIIGSTMSVATRSTVTAIGSLIMLFITSPRL 206 Xyle...
CMCP6:VV2_0179           87 LVSSVGERVSADIRLAVFNHVITLHPSYFETNSSGDIMSRLTTDTTLLQSIIGSSFSMAMRSALMCVGAIIMLFATNFKL 166 Vibr...
AAN56650                 91 LMTWLGERVSADIRLAVYNQLLKLSPAFYAKVRTGEVISRFTADSTLLQTVVGSSLSMALRSGVTVIGGLAMMGITSVKM 170 Shew...
WP_003112499             88 LVSWIGERFVADIRKRVFDHLIELHPGFYETNRSSEIQSRLTADTTLLQTVIGSSLSMALRNALMLVGGVLLMFVTNAKL 167 Pseu...
CAC47354                172 SSLVLAAIPLIVFPLVGFGRSVRRRSREAQDMLAAASAYAGEAIAATRTVQAFNGEESARSRYGSAVEAAYRAARAATRA 251 Sino...
BAC46773                209 SGFVLLAIPLIVLPLVAFGRWVRRLSRNAQDTLAEASAYAGELVGAIRTVQAYTSEGLAAKRFGGEVEQAYEAARTSTQA 288 Brad...
AAK25236                196 AGFIVLMVPVILAPMFLVGRRVRKLTVTAQDRFADAVGYAGESLDALETVQAFGRESASSGRFGAAVEAAYKASVRRITT 275 Caul...
tigr:EBAC080-L028H02.67 177 TGLLLLIVPIVALPVLTLGRRLRVLSRENQDFIAASSGNASEVLSALQTVQAFTHETASRQTFDRVTEKSFEVAAQRINT 256 uncu...
AAO29791                207 ASLSLVVIPFVILPIFLGAQHLQKAARTSQDRIADTNSFAAETLRALRTVQAYAREHYERTRFDRALETSLQAARQRIHI 286 Xyle...
CMCP6:VV2_0179          167 TLIVLASVPFVLVPILVYGRRVRALSRQSQDSMADVGSYAGEAIEHIKTVQSFSSEQHEKAAFAVEVEKAYEIGRQRVKQ 246 Vibr...
AAN56650                171 TLLVLLAVPLVLGPVSFFGRKVRTLARESQDRVADLGAYVDETLHEIHTVQAYGHEDKDRSLFNGRVEDVMTAASGRIRY 250 Shew...
WP_003112499            168 TSIVVLALPLVIAPILLFGRRVRSLSRESQDRVADVGSYVGETLGQIKTVQAYNHQAQDRQRFAGTVERAFDTARKRIAQ 247 Pseu...
CAC47354                252 RSVLTAFAITMVFGSVVAVLWFGARDVLADSLSAGTLGQFLLYSVFAAGSLGALSEVWGELSQAAGAAERLNELLNEVPE 331 Sino...
BAC46773                289 RAVLTAIIIFIVFASVVAILWIGSHDVLTGAISPGRLGQFVLYAAFAAAGLGQLSEVWGEVSAASGAAERLFEILHVQPD 368 Brad...
AAK25236                276 RATMTAMVITLAFGGITLLLWTGARLVLAGEMTGGTLAQFAMLAVMAAGSIGALGEVWGDVQKASGAMDRISELLNAKPD 355 Caul...
tigr:EBAC080-L028H02.67 257 RVLMTMIVIYMIFSGVVGVLWIGVHDIRSNAISAGELAQFVIYAILVAGSASALSEIWGELQRAAGATERLVELLQAQDT 336 uncu...
AAO29791                287 QTWVTAASIVLIFSAIVGVLWAGAHDVIAGRMSAGTLGEFVLYALISGGSIGSLAEVWNELQRAAGGMGRIFELLKEKNT 366 Xyle...
CMCP6:VV2_0179          247 RAILISGVIVIVFGAIAGMLWVGGSDVIHGKMSAGDLGAFVFYAIMVASSTATISEVLGELQRAAGATERLIEILQVESD 326 Vibr...
AAN56650                251 RALLISSVMFLSIAAIALVTWVGAHDVMSGKMTGGELSAFMFYAVMVAGAVATISEVVGEIQRASGAAERLIELAETEVD 330 Shew...
WP_003112499            248 RAWLITVVIVLVLGAVGIMLWVGGRDVIAGSISAGELAAFVFYSLIVGMAFGTLSEVIGELQRAAGAAERIAELLRARSE 327 Pseu...
CAC47354                332 IEAPEHPVAMPVPATGAVEFENVHFAYPARPDYKSLRGLSFAVRPGETVAIVGPSGAGKSTVFSMLLRYYDPAKGTIRVD 411 Sino...
BAC46773                369 IKAPASPRALPVPARGEVGFDQVSFAYPARLDVKVLDAVSFTVRPGEKVAIVGPSGAGKSTIFHLLLRFYDPRSGAISLD 448 Brad...
AAK25236                356 IAAPPQPKTLPVPGQGEIAFENVVFAYPGRPDLPALNGFDLRVKPGETVALVGPSGAGKSTVLRLLLRFYDPQSGCILLD 435 Caul...
tigr:EBAC080-L028H02.67 337 VTEPKNPLDLSQPLRGEIIFDDVHFRYPARPDRLSLSQINLTINPGETVALVGPSGAGKTTIIQLILRFYDPTSGQVRLD 416 uncu...
AAO29791                367 LSVPATPTLPPHPLRGEIRFERVGFHYPQRPETPALDGIDLHIRPGETIAFVGPSGAGKSTLLSLLLRFYDPTHGRILID 446 Xyle...
CMCP6:VV2_0179          327 IKAPSHQQSIPADIPAEVSFDSVNFNYPSRPNQPAIKGLNLTAEQGKVLALVGPSGAGKTTLFELLQRFYDPQQGHVLLG 406 Vibr...
AAN56650                331 IPAPLVPKTLPTKVRGELQLHQLNFHYPEQT-QLVLSDLNLVINAGERVALVGPSGAGKSTLFQLLQRFYVPSSGSILLD 409 Shew...
WP_003112499            328 IRPPAQPRKLAARVSGRIELQAVRFAYPTRPEHWAIDDISLAVEPGETLALVGPSGAGKSTLFDLLLRFFDPQQGRLLLD 407 Pseu...
CAC47354                412 GTDVRAVDPEELRERLAIVPQDVTIFATSVHDNIAFGVPDASREAVRAAAVAAQADEFIGRLDRGYDTLVGERGVTLSGG 491 Sino...
BAC46773                449 GVPVRSADPRDFRSRIALVPQESNVFAASARENIRFGRPDATDAEVERAAELAHAAEFVRRLPEGFDTPLGERGVTLSGG 528 Brad...
AAK25236                436 GVNLRDAEPAEVRARMALVAQDSPLFSGSAMDNIRFGRPDATDEQVRAAADAAQATGFLSALPEGFDTPVGERAKTLSGG 515 Caul...
tigr:EBAC080-L028H02.67 417 GVNLCDLRRDVFRNVVALVPQDPVVFAASALENIRFGNPEASDEQVYAAARAAVAHEFITQLPDGYDSYLGERGVMLSGG 496 uncu...
AAO29791                447 GVDLRQTDPKVLRTHIALVQQQPTLFTASAMENIRYGRLDATTAEIEIAARSSEADGFIRALPQGYATELGEHGLSLSGG 526 Xyle...
CMCP6:VV2_0179          407 GIDIRQFDPNELRQQMALVPQQPALFSHDVFHNIRYGNPDATDEQVIEAAKKAHAHEFIEKLPEGYHSFLGERGVRLSGG 486 Vibr...
AAN56650                410 GIDIAALSPQDLRAQFALVPQDSVIFATSVLENVRYGRVDASEQEVIDACIAARAHEFISEFSEGYQTYLGERGVRLSGG 489 Shew...
WP_003112499            408 GQPIVELDPADLRRSFALVSQNPALFFGSVEENIRYGRPHASAAEVEAAARAAHAHEFILGLPQGYATHLGEGGIGLSGG 487 Pseu...
CAC47354                492 QRQRIAIARAILKNAPILLLDEATSALDAESETLVQKALDVLMQERTTLVIAHRLATVLKADRILVMEHGRIVEEGTHES 571 Sino...
BAC46773                529 QRQRIAIARAILRDAPLLLLDEATSALDAESETLVQTALEELMKHRTTLVIAHRLATVLSCDRILVMDQGKIVEQGTHAE 608 Brad...
AAK25236                516 QRQRLAIARALVREAPILLLDEATSALDAESEQLVQQALATAMEGRTTLVIAHRLATVLKADRIVVMEEGRVVEQGAHAE 595 Caul...
tigr:EBAC080-L028H02.67 497 QKQRIAIARAILRDAPVLLLDEATSALDAESEQAVKLAVETLSSDRTTIIIAHRLATVKKADRIVVMDKGQIVDTGTHDE 576 uncu...
AAO29791                527 QQQRIAIARALLKEAPILLLDEATNALDAQNEQAVQQALERLMTGRTTLIIAHRLVTILKADRIVVMDQGRIVAQGTHSE 606 Xyle...
CMCP6:VV2_0179          487 QKQRIAIARAILKDPKILLLDEATSALDSESEHHVQQALEALMKGRTTLIIAHRLSTIQHADKIAVLDNGELVDIGNHHA 566 Vibr...
AAN56650                490 QKQRIAIARAILADRPILLLDEATSALDALSEQKVKQALDELMAGKTTLIIAHRLATVINADRIIVFDKGRIVASGKHQD 569 Shew...
WP_003112499            488 QRQRLAIARALLVDAPVLLLDEATSALDAESEHLIQQALPGLMSGRTTLVIAHRLATVQSADRIAVIDQGRLVAIGSHAR 567 Pseu...
CAC47354                572 LIRQGGLYAKLARLQF 587 Sinorhizobium meliloti 1021
BAC46773                609 LVAANGLYARLARLQF 624 Bradyrhizobium diazoefficiens USDA 110
AAK25236                596 LFAKGGLYARLARLQF 611 Caulobacter crescentus CB15
tigr:EBAC080-L028H02.67 577 LVAKGGLYAHLARLQF 592 uncultured marine bacterium 582
AAO29791                607 LIAAGGLYAKLARLQF 622 Xylella fastidiosa Temecula1
CMCP6:VV2_0179          567 LMQSCELYQRLVALQF 582 Vibrio vulnificus CMCP6
AAN56650                570 LIKTNALYREFATLQL 585 Shewanella oneidensis MR-1
WP_003112499            568 LIAENPLYARLAELQF 583 Pseudomonas aeruginosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap