3B5W


Conserved Protein Domain Family
MsbA_lipidA

?
TIGR02203: MsbA_lipidA 
Click on image for an interactive view with Cn3D
lipid A export permease/ATP-binding protein MsbA
This family consists of a single polypeptide chain transporter in the ATP-binding cassette (ABC) transporter family, MsbA, which exports lipid A. It may also act in multidrug resistance. Lipid A, a part of lipopolysaccharide, is found in the outer leaflet of the outer membrane of most Gram-negative bacteria. Members of this family are restricted to the Proteobacteria (although lipid A is more broadly distributed) and often are clustered with lipid A biosynthesis genes. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides, Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 131258
View PSSM: TIGR02203
Aligned: 7 rows
Threshold Bit Score: 896.769
Threshold Setting Gi: 24986705
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3B5W_A        12 TFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFG-----------------------------KTDRS 62  Shigella dysent...
P27299        12 TFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFG-----------------------------KTDRS 62  Escherichia coli
AAO28241      16 TYRRLLSYAREYRWLLVVAACGALLEAVAGSTFLALMKPITNETFIe-----------------------------RNRE 66  Xylella fastidi...
CAE33882      19 LWKRVYSRVGSYWKGLVLAVLLMAGAAATQPTLAVIMKPLLDDGFSg-----------------------------AKPH 69  Bordetella bron...
CAD15907      19 HFKRLWAYLRPELSSFILAMVAMGVVAATEGIIPKVVKDLLDQGFGg-----------------------------EYAG 69  Ralstonia solan...
WP_002247090  17 SFMRLMAYVRPYKIRIVAALIAIFGVAATESYLAAFIAPLINHGFSapaappelsaaagilstlqnwreqftymvWGTEN 96  Neisseria menin...
AAN70502      16 IYFRLLSYVKPYVGIFLLSIVGFVIFASTQPMLAGILKYFVDGLSNpeavlf------------------pnvpyLRDLQ 77  Pseudomonas put...
3B5W_A        63 VLVWMPLVVIGLMILRGITSYVSSYCISWVSGKVVMTMRRRLFGHMMGMPVSFFDKQSTGTLLSRITYDSEQVASSSSGA 142 Shigella dysent...
P27299        63 VLVWMPLVVIGLMILRGITSYVSSYCISWVSGKVVMTMRRRLFGHMMGMPVSFFDKQSTGTLLSRITYDSEQVASSSSGA 142 Escherichia coli
AAO28241      67 VALWLPLGIVGLFLLRGIAGYITDMAMGRAARSIARDFRVCVLTKYFRLPGSRFDGEPVASMLVRLGSDSEQVAHAVIDA 146 Xylella fastidi...
CAE33882      70 YVWFLPLAVVGLILLRGICNFFSDYLLAWVANNVLRGIRGEMFERLLGLPDADFKRGDTGRLLNRFTIDAGNVTGYATDV 149 Bordetella bron...
CAD15907      70 KLWRVPAMLVGIAVVRGVAQFGATYFLSLVSNKVLLNLRMKMFERLLQAPAAFYQRNTAASLINAVIFEVNQVLQVLTGV 149 Ralstonia solan...
WP_002247090  97 KIWTVPLFLIILVVIRGICRFTSTYLMTWVSVMTISKIRKDMFAKMLTLSSRYHQETPSGTVLMNMLNLTEQSVSNASDI 176 Neisseria menin...
AAN70502      78 LLQAVPLLIILIAAWQGLGSFLGNYFLAKVSLSLVHDLRVALFNKLLVLPNRYFDNHNSGHLISRITFNVTMVTGAATDA 157 Pseudomonas put...
3B5W_A       143 LITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSIAIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGG 222 Shigella dysent...
P27299       143 LITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSIAIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGG 222 Escherichia coli
AAO28241     147 MKVMVQQTLQVIGALVVMLWYSWTVTLAILLVAPLLAWVMQRVAKRYRRISHHIQESNAQLMQAADQALSNYQDVKVYAA 226 Xylella fastidi...
CAE33882     150 ITVLVRETLVVIALIGVLLYMSWALTLIILVMLPVSVGIARAFTRRLRRINRETVNMNAELTRVVSEGIDGQRVIKLFDG 229 Bordetella bron...
CAD15907     150 FITLVRDSMTVLALLIFLFYTNWRLTLVVAVILPVIGFLMSRINRRLRSLNREHQNLTNEAAYVVEEAAGGYKVVKLHGG 229 Ralstonia solan...
WP_002247090 177 FTVLTRDTMIVTGLTIVLLYLNWQLSLIVVLMFPLLSLLSRYYRDRLKHVISDSQKSIGTMNNVIAETHQGHRVVKLFNG 256 Neisseria menin...
AAN70502     158 IKVVIREGLTVVFLFAYLLWMNWHLTLVMVAILPVIAVMVSIASKKFRKQSKKIQVAMGDVTHVASETIQGYRVVRSFGG 237 Pseudomonas put...
3B5W_A       223 QEVETKRFDKVSNRMRLQGMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSltAGTITVVFSSMIALMRPLKSLT 302 Shigella dysent...
P27299       223 QEVETKRFDKVSNRMRLQGMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSltAGTITVVFSSMIALMRPLKSLT 302 Escherichia coli
AAO28241     227 QESELERYARLANINLGLAVKVESTRSISSAAVQLLGAVGLAMLLLIAGHEALAGRlsPGDFVSLMTSMIAVIPALKQLT 306 Xylella fastidi...
CAE33882     230 YDAERRRFDFVNSRLRRFAMRSATADAALTPLTQVCISVAVGAVIAVALSQANSGAltVGSFASFMAALAQIFDPIKRLT 309 Bordetella bron...
CAD15907     230 EAYESRRFNAMTNRLRGYAMRMAVAGGLNQPVTQFLAALALSVILAIAMVQAQANQttVGGFTGFVMAMLLLISPLKHLT 309 Ralstonia solan...
WP_002247090 257 QAQAANRFDAINRTIVRLSKKITQATAAHSPFSELIASIALAVVIFIALWQSQNGYttIGEFMAFIVAMLQMYAPIKSLA 336 Neisseria menin...
AAN70502     238 EAYEQQRFGQASQSNTDKQLRMTKTGSLYTPMLQLVIYSAMAALMFLVLFLRGDST--AGDLVAYITAAGLLPKPIRQLS 315 Pseudomonas put...
3B5W_A       303 NVNAQFQRGMAACQTLFTILDSEQEKDEGKRVIER-ATGDVEFRNVTFTYPGRDVPALRNINLKIPAGKTVALVGRSGSG 381 Shigella dysent...
P27299       303 NVNAQFQRGMAACQTLFTILDSEQEKDEGKRVIER-ATGDVEFRNVTFTYPGRDVPALRNINLKIPAGKTVALVGRSGSG 381 Escherichia coli
AAO28241     307 NVQNMLQSGIASAQRLFSVLDSPDELDTGRRPLGR-ARGLIEFRGITARYPGRSAPVLDSVSFVAAPGTVTAIVGRSGSG 385 Xylella fastidi...
CAE33882     310 NLAGKMQKMLVAAESVFTLVDQTPEADAGTRALPEpVRGKVEFRAVSHRFPDADRDTVSAVSFLVEPGQTVALVGRSGSG 389 Bordetella bron...
CAD15907     310 DVNQPMQRGLTAAEFIFGLIDTPIEPQDGGKHIDR-ARGDLRFEHVTFRYGPDGRAALDSIDLHVKAGEIVALVGPSGSG 388 Ralstonia solan...
WP_002247090 337 NISIPMQTMFLAADGVCAFLDTPPEQDKGTLAPQR-VEGRISFRNVDVEYRSDGIKALDGFNLDIRQGERVALVGRSGSG 415 Neisseria menin...
AAN70502     316 EVSSTIQKGLAGAESIFEQLDEAPEVDTGTVEKER-VEGRLEVRNLSFTYPGTEREVLSDISFVAEPGQMIALVGRSGSG 394 Pseudomonas put...
3B5W_A       382 KSTIASLITRFYDIDEGEILMDGHDLREYTLASLRNQVALVSQNVHLFNDTVANNIAYARTe--QYSREQIEEAARMAYA 459 Shigella dysent...
P27299       382 KSTIASLITRFYDIDEGEILMDGHDLREYTLASLRNQVALVSQNVHLFNDTVANNIAYARTe--QYSREQIEEAARMAYA 459 Escherichia coli
AAO28241     386 KSSLIKLIPRFYEPESGQILLDGHPLQDYLLADLRRQIALVGQQVMLFDGSIADNIAYGEMr--QVVSEEIERVVVDANA 463 Xylella fastidi...
CAE33882     390 KTTLVNMLPRFVLPDGGDILFDDVPIQDLTLRSLRSHLSLVSQDVVLFDDTIAANVGYGAGg--TVDDARVRDALAAANL 467 Bordetella bron...
CAD15907     389 KTTLVNLLPRFFEPTSGRIVLDGDALADLSLQDLRRQIAFVSQDVVLFNDTIAANVAYGARdasEIDMARVRRALEAAYL 468 Ralstonia solan...
WP_002247090 416 KSTVVNLLPRFVEPSAGNICIDGIDIADIKLDCLRAQFALVSQDVFLFDDTLFENVRYSRP---DAGEAEVLSALQAANL 492 Neisseria menin...
AAN70502     395 KSTLAALIPRFYHHDKGQILLDGVEIEHYRLRNLRRHVSQVTQHVTLFNDTVANNIAYGDLa--GAPRADIEAAAADAYA 472 Pseudomonas put...
3B5W_A       460 MDFINKMDNGLDTVIGENGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRL 539 Shigella dysent...
P27299       460 MDFINKMDNGLDTVIGENGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRL 539 Escherichia coli
AAO28241     464 QDFVNQLPEGLQFQVGVKGGRLSGGQRQRLAIARAMLKDAPILILDEATAALDNESERLVQDALQRLMPERTTLVIAHRL 543 Xylella fastidi...
CAE33882     468 LEFVDGLPLGIHTPVGQNAARLSGGQRQRLAIARALIKNAPVLILDEATSALDNESERQVQASLERLMRGRTTLVIAHRL 547 Bordetella bron...
CAD15907     469 TDVVDNLPDGVDTNIGDNGSKLSGGQRQRLAIARAVYKDAPILILDEATSALDSESERQVQAALEALMQGRTTLVIAHRL 548 Ralstonia solan...
WP_002247090 493 QSLIDASPLGLHQPIGSNGSNLSGGQRQRVAIARAILKDAPILLLDEATSALDNESERLVQQALERLMENRTGIIVAHRL 572 Neisseria menin...
AAN70502     473 KEFVDRLPKGFDTEVGENGVLLSGGQRQRLAIARALLKNAPLLILDEATSALDTESERHIQAALDHVMQGRTTLVIAHRL 552 Pseudomonas put...
3B5W_A       540 STIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ 582 Shigella dysenteriae Sd197
P27299       540 STIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ 582 Escherichia coli
AAO28241     544 STIKHADQVLVMDQGRIIESGTHVDLLARDGLYAYLYSMQFRE 586 Xylella fastidiosa Temecula1
CAE33882     548 STVQNADRIIVLDAGKIVEHGPHSELLAANGLYASLYNMQFRE 590 Bordetella bronchiseptica RB50
CAD15907     549 STIENADRIVVLEHGQIVEAGTHRELLDRDGLYAGLHRIQFAT 591 Ralstonia solanacearum GMI1000
WP_002247090 573 TTIEGADRIIVMDDGKIIEQGTHEQLMSQNGYYTMLRNISNKD 615 Neisseria meningitidis
AAN70502     553 STIEKADQILVMDQGRLVERGTHTELLAANGHYARLHAMGLDE 595 Pseudomonas putida KT2440
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap