Conserved Protein Domain Family
heptsyl_trn_III

?
TIGR02201: heptsyl_trn_III 
lipopolysaccharide heptosyltransferase III, putative
This family consists of examples of the putative ADP-heptose:LPS heptosyltransferase III, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. This enzyme may be less widely distributed than heptosyltransferases I and II. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 131256
View PSSM: TIGR02201
Aligned: 3 rows
Threshold Bit Score: 578.398
Threshold Setting Gi: 34102130
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAD37767      15 RILVIKLRHHGDMLLITPLIHALKQQYPAASVDVLLYEETRDMLAANPDIHHIYGLDRRWKkqGKRyQLKMQWQLIQTLR 94  Klebsiella pneu...
AAQ58497       9 RILLIKLRHHGDILLTTPVARTLKSRFPQCEIDMLVYRETVPLLQHNPDIARVWTLDRSLR--GWR-KLVSQLRLLLALR 85  Chromobacterium...
WP_000360402   7 RILLIKMRFHGDMLLTTPVISSLKKNYPDAKIDVLLYQDTIPILSENPEINALYGIKNKKAkaSEK--IANFFHLIKVLR 84  Enterobacteriaceae
AAD37767      95 QQRYDMVLNLADQWPSAVISKLTGAATRIGFDFPKRRHPVWRYCHTALASTQQHNQLHTVQQNLSILAPLGLQLNDAPAR 174 Klebsiella pneu...
AAQ58497      86 RRRYQTVIHLSDQMQGAFFAKLLARRHAIGFDYPKRRKSPWHRFFTALAPLAPSDTLHTVSQNLLALSPLGITPTADEQR 165 Chromobacterium...
WP_000360402  85 ANKYDLIVNLTDQWMVAILVRLLNARVKISQDYHHRQSAFWRKSFTHLVPLQGGN---VVESNLSVLTPLGLDSLVKQTT 161 Enterobacteriaceae
AAD37767     175 --MGYSEADWAASRALLPED-CREHYIVIQPTSRWFFKCWREDRMSALINALSAEGYAVVLTSGPDAREKKMVDTIIAGC 251 Klebsiella pneu...
AAQ58497     166 cvLPIQASDREAVAALLREAgVSGPYIVIHPSSRWFFKCWEDDRFAGLAEALASDGWSIVLTAAPDPAEMDMVAAIQGKI 245 Chromobacterium...
WP_000360402 162 --MSYPPASWKRMRRELDHAgVGQNYVVIQPTARQIFKCWDNAKFSAVIDALHARGYEVVLTSGPDKDDLACVNEIAQGC 239 Enterobacteriaceae
AAD37767     252 PQARLHSLAGQLTLRQLAAVIDHARLFIGVDSVPMHMAAALGTPLVALFGPSKLTFWRPWQAKGEVIWAGDFGPLPDPDA 331 Klebsiella pneu...
AAQ58497     246 RSDRVVSVAGRLTLNQLAAIIDGARMFIGVDSVPMHMAAALGKDTVALFGPSKIHEWHPWMTRHRLLNAADYGELIDPDQ 325 Chromobacterium...
WP_000360402 240 QTPPVTALAGKVTFPELGALIDHAQLFIGVDSAPAHIAAAVNTPLISLFGATDHIFWRPWSNNMIQFWAGDYREMPTRDQ 319 Enterobacteriaceae
AAD37767     332 INTNTDERYLDLIPTDAVIAAAKKVLA 358 Klebsiella pneumoniae
AAQ58497     326 VDTSTRQRYLKNIPLEAALRASRELLS 352 Chromobacterium violaceum ATCC 12472
WP_000360402 320 RDRN--EMYLSVIPAADVIAAVDKLLP 344 Enterobacteriaceae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap