Conserved Protein Domain Family
GlrX_actino

?
TIGR02200: GlrX_actino 
Glutaredoxin-like protein
This family of glutaredoxin-like proteins is limited to the Actinobacteria and contains the conserved CxxC motif.
Statistics
?
PSSM-Id: 131255
View PSSM: TIGR02200
Aligned: 4 rows
Threshold Bit Score: 124.185
Threshold Setting Gi: 499339275
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC17727        3 HATIYATDWCPYCASLMRGLkDLDPAEYEVIDVDQDEEAGEWVKSVNdGNRIVPTVKFSDGSHATNPPVAEVIAKIQD 80  Corynebacterium ...
nestle:BL0079   2 TIDVYGATWCGDCRQAKNTL-DKLGAAYTWHNIEEEEGAADRAVAIS-GQMHIPVVRYDDGSFQVEPSAVDIKNKLQE 77  Bifidobacterium ...
AAS05848        5 PLTVYTTSWCGYCHRLMTVL-KSNGIPYEAVDIEHDPAAADFVSSVNgGNKTVPTVKFADGSTLTNPSAAQVKAKLAE 81  Mycobacterium av...
WP_011028983   11 KVQMYWRPGCPYCAMLRRQL-RRTGLSYEPVDIWKDQSGAAYVRSVNnGNETVPTVAVAG-HPLTNPSARQVLEAVQR 86  Streptomyces coe...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap