Conserved Protein Domain Family
rfaE_dom_II

?
TIGR02199: rfaE_dom_II 
rfaE bifunctional protein, domain II
RfaE is a protein involved in the biosynthesis of ADP-L-glycero-D-manno-heptose, a precursor for LPS inner core biosynthesis. RfaE is a bifunctional protein in E. coli, and separate proteins in some other genome. Domain I (TIGR02198) is suggested to act in D-glycero-D-manno-heptose 1-phosphate biosynthesis, while domain II (this family) adds ADP to yield ADP-D-glycero-D-manno-heptose. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 131254
View PSSM: TIGR02199
Aligned: 14 rows
Threshold Bit Score: 225.645
Threshold Setting Gi: 27354204
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAA50211      18 ALAARIAALPRPLVFTNGVFDILHRGHATYLAQARALGASLVVGVNSDASVKMlGKGDDRPLNHESDRMALLAALESVDL 97  Ralstonia eutro...
AAR35461     342 GIIAAEKAQGKRVVFTNGCFDLLHVGHVKYLQKARSFGDLLVLGLNSDASIRR-LKGEKRPLIGQEERAHILAALDCIDY 420 Geobacter sulfu...
AAS70135      15 AFADQVRKN-KKIVFTNGCFDLVHKGHITYLSQARELGDFLWIGLNSDSSVKR-LKGEQRPLICEEDRAILLSNLRFVDA 92  Leptospira inte...
Q9ZKZ0       324 TLER----NQQKIVFTNGCFDILHKGHASYLQKAKALGDILVVGLNSDNSIKR-LKGDKRPIVSEKDRAFLLASLSCVDY 398 Helicobacter py...
AAK25602     340 RIVEGWRARGLKVGFTNGCFDLLHPGHVSLLSQAKAACDRLIVGLNTDASVSK-LKGPTRPVQKEQGRATVLASLSSVDL 418 Caulobacter cre...
BAC51192     348 AQLAEWRTQGLRVGFTNGCFDILHPGHVKVLTAARGACDRLVVGLNSDASVRR-LKGADRPVQDERARAEVLAALEAVDL 426 Bradyrhizobium ...
AAN02283     330 RAVEQAKQRGEKIVMTNGCFDILHPGHVSYLENARKLGDRLIVAVNTDESVKR-LKGESRPINDLNARMAVLAGLASVDW 408 Actinobacillus ...
CAD83588     332 YVVSVVRGRGEKIVMTNGVFDILHYGHISYLMDAKKLGHRLIVAVNSDKSTRR-LKGKHRPINVLERRMFVLSALSMVDW 410 Candidatus Bloc...
AAO58411     329 LAVDDARAHKEKIVFTNGCFDILHAGHVTYLEQARAQGDRLIVAVNDDASVSR-LKGPGRPINSVDRRMAVLAGLGAVDW 407 Pseudomonas syr...
WP_010880070   9 lkvlereRKGKKVVFTNGCFDIIHAGHVDYLEKAKKLGDILVVGMNSDSSVRR-IKGERRPIIPQEMRAKVLSSLKPVDY 87  Aquifex aeolicus
AAA50211      98 VAMFREQTPVELIRLVRPDIYVKGGDYDIDTLEETRLVRSWGGQAYAIPFLHDRSTTKLLTRVRQ 162 Ralstonia eutropha H16
AAR35461     421 VVVFDEDTPLNLIETLRPAVLVKGGDYTLDGVVGREVVESYGGRVELVAFVDGRSTTNIIEKILK 485 Geobacter sulfurreducens PCA
AAS70135      93 VTIFSQDTPLDLIRLIKPKIHVKGGDYKVEELPETKIIRELGGDVQILPFVPGKSTSSIIEKILK 157 Leptospira interrogans serovar...
Q9ZKZ0       399 VVVFGEDTPIKLIQALKPDILVKGADYLNKEVIGSELAK----ETRLIEFEEGYSTSAIIEKIKR 459 Helicobacter pylori J99
AAK25602     419 VVLFDEDTPLELIKAFRPDVLVKGADYTVETVVGSDVVLGYGGKVVLAELKQGQSTTNLIARMNS 483 Caulobacter crescentus CB15
BAC51192     427 VVIFEEDTPIDLITRIKPAALVKGGDYTREQVVGHEVVEAAGGVVVLVDILQGFSTTALVHRARG 491 Bradyrhizobium diazoefficiens ...
AAN02283     409 VVPFAEDTPQRLIGEILPNLLVKGGDYKPEEIAGSQEVWANGGEVKVLNFENGCSTTNVIKKIQA 473 Actinobacillus pleuropneumoniae
CAD83588     411 VVSFDEDNPIQLILEISPDFLVKGGDYNVNNIVGGKEVLRQGGQVCVLKFQEDCSSSSIIDTMEI 475 Candidatus Blochmannia floridanus
AAO58411     408 VISFPEGTPENLLTHVKPDVLVKGGDYGIDQVVGADIVQAYGGEVRVLGLVENSSTTAIVEKIRG 472 Pseudomonas syringae pv. tomat...
WP_010880070  88 VVIFEEDTPEKLIKAIKPDVLVKGGDWPLDKIVGREFVESYGGKVLTIPFEYDISTSKIVQKVLE 152 Aquifex aeolicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap