1H75


Conserved Protein Domain Family
GlrX_NrdH

?
TIGR02194: GlrX_NrdH 
Click on image for an interactive view with Cn3D
Glutaredoxin-like protein NrdH
NrdH-redoxin is a representative of a class of small redox proteins that contain a conserved CXXC motif and are characterized by a glutaredoxin-like amino acid sequence and thioredoxin-like activity profile. Unlike other the glutaredoxins to which it is most closely related, NrdH aparrently does not interact with glutathione/glutathione reductase, but rather with thioredoxin reductase to catalyze the reduction of ribonucleotide reductase.
Statistics
?
PSSM-Id: 131249
View PSSM: TIGR02194
Aligned: 8 rows
Threshold Bit Score: 117.905
Threshold Setting Gi: 29342563
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1H75_A        3 ITIYTRNDCVQCHATKRAMENRGFDFEMINVDRVPEAAEALRAQGFRQLPVVIA-GDLSWSGFRPDMINRLH 73  Escherichia coli
Q56108        3 ITIYTRNNCVQCHATKRAMESRGFEFEMVNVDLVPDAADTLRAQGFRQLPVVMA-GDLSWSGFRPDMINRLH 73  Salmonella enterica subs...
AAO80328      3 VKIFSKNNCIQCKMAKRFLSENNIAFEEINIDAQPDAIDWLKEQGFQSVPVITSeAT-TVVGFRPDQLKQLA 73  Enterococcus faecalis V583
AAN58403      4 ITVFSKNNCMQCKMTKKFLEQHNADFEEINIDEQPEKIEYVKSLGFTAAPVIETsDL-VFSGFQPAKLKTII 74  Streptococcus mutans UA159
Q48708        2 VTVYSKNNCMQCKMVKKWLSEHEIAFNEINIDEQPEFVEKVIEMGFRAAPVITKdDF-AFSGFRPSELAKLA 72  Lactococcus lactis subsp...
WP_010908518  4 ITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQAPVVVA-GNNHWSGFRPDRIKALA 74  Mycobacterium leprae
WP_002212214  3 IIIYSKPDCVQCNATYRAFDRQGISYQIIDLTEDEQALNHVKSLGYQQVPVIVA-GDEHWSGFHPDKINALV 73  Yersinia
CAD63298      4 VTVFTKNNCMQCKMTKKFLTAHNIAFEEKNINTNPEYVDYLKNQGFHAVPVVEInGEDSIAGFRPDALKQLA 75  Lactobacillus plantarum ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap