Conserved Protein Domain Family
HtrL_YibB

?
TIGR02192: HtrL_YibB 
protein YibB
The protein from this rare, uncharacterized protein family is designated HtrL or YibB in E. coli, where its gene is found in a region of LPS core biosynthesis genes. Homologs are found in Shigella flexneri, Campylobacter jejuni, and Caenorhabditis elegans only. The htrL gene may represent an insertion to the LPS core biosynthesis region, rather than an LPS biosynthetic protein. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 131247
View PSSM: TIGR02192
Aligned: 3 rows
Threshold Bit Score: 377.297
Threshold Setting Gi: 13123728
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P25666      1 MKSSTTIITAYFDIGRGDWTAnkgfrekLARSVDVYFSYFERLAALENEMIIFTSPDLKPRVEAIRNGKPTTVIVIDIKK 80  Escherichia coli K-12
AAK12949    2 IDNEITIVTAFYDIGRKDIKN-------FERDNDKYLSYFEFLAGIKNKMIIYTQENIKEKILDTRKKHNLEDKTIIITK 74  Campylobacter jejuni
NP_505916 461 VEREVTLVTGFLDIGRGDWDI-------YRRPLETYHKFMETLLTLENNFVVFTDESSYDFVVKTRTKLGLMDKTKVHKI 533 Caenorhabditis ele...
P25666     81 KFRYIRSR------IEKIQKDES----FTNRLEPRQLKNPEYWSPEYVLVCNLKAYFVNKAINMGLVKTPlVAWIDFGYC 150 Escherichia coli K-12
AAK12949   75 ELQEFDEQg----yKKIIDTFRN----YDQSINRKNPNNIECISPMYCYLMYLKPFFVCDAIQRGLTDEN-IMWLDFGFN 145 Campylobacter jejuni
NP_505916 534 TLDDLPLYsyineaKKIINDELNnetfYRTIADLDMKTHPESISAEYNIVVNSKTHFLHNVTMENPFNSEhFVWLDAGYG 613 Caenorhabditis ele...
P25666    151 HK-PNVTRGLKIWDFPFD------ESKMHLFTIKKgltvTSQQQVFDFMIGNHVYIIGGAIVGSQHKWKEFYKLVLESQK 223 Escherichia coli K-12
AAK12949  146 HG-GNFFVDKDQFNFYLQeqnsidENKINLFSIKN----DDKQTLANIYFSMETFLMGGIIFAKPKNWLLFKHHMQKCIK 220 Campylobacter jejuni
NP_505916 614 HAnENHFPYSYKWQPALP------DGKISLIKVTPyfdeVSSYDLKRLYRKNVALLSGGFIAGDKHAIGQLHSIIHRKFI 687 Caenorhabditis ele...
P25666    224 ITLNNNIVDDDQgiFVMCYYKRPDLFNLNYLGRGKWFDLFRCFRSNTLGAKMQA 277 Escherichia coli K-12
AAK12949  221 YFTSFGIIDDDQ--IMLLWCARNYRKNYNIIKVYFWFDSLYHFIPQNIAKKLKI 272 Campylobacter jejuni
NP_505916 688 QLIYQNHVDDDQ---TLLTLAVNSFPQLFHIVLGDWFDAFRLFASD---PEVQM 735 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap