Conserved Protein Domain Family
GlrX-dom

?
TIGR02190: GlrX-dom 
Glutaredoxin-family domain
This C-terminal domain with homology to glutaredoxin is fused to an N-terminal peroxiredoxin-like domain.
Statistics
?
PSSM-Id: 131245
View PSSM: TIGR02190
Aligned: 5 rows
Threshold Bit Score: 150.76
Threshold Setting Gi: 33148096
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAE33503     164 APQARKPDQVVVFSKPGCPFCVDAKALLKGKGFDPIEIPLDNKVRGRVIGAVSGGDTAPQVFINGKLIGGFDALKAYLA 242 Bordetella bronc...
AAQ59708     164 NPSAKKPDQVVVFTKVGCPHCARAKAVLAENGYDFVEVPLDNKIRGKVLGAVSGAMTAPQVFINGELIGSADEVEKRFA 242 Chromobacterium ...
BAC61016     164 APEYRTQESITVFTKPGCPFCMKAKQNLIDHGLQYEEVILGKDATSVSLRAITGRTTVPQVFIGGKHIGGSEELETYLG 242 Vibrio parahaemo...
AAP95617     165 VAGWQAKESVSIITKPGCPFCAKAKETLKAKGYAFEEIVLGRDASTISVRAITGKTAVPQVFIGGKHIGGSDELTAYFA 243 Haemophilus ducr...
WP_010995710 164 NPQAAKPKLVSLFTKVGCPFCARAKAALQENGIEYEEITLGKGITTRSLRAVTGATTVPQVFIDGVLIGGSEALTDYLS 242 Nostoc sp. PCC 7120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap