2P2F


Conserved Protein Domain Family
Ac_CoA_lig_AcsA

?
TIGR02188: Ac_CoA_lig_AcsA 
Click on image for an interactive view with Cn3D
acetate--CoA ligase
This model describes acetate-CoA ligase (EC 6.2.1.1), also called acetyl-CoA synthetase and acetyl-activating enzyme. It catalyzes the reaction ATP + acetate + CoA = AMP + diphosphate + acetyl-CoA and belongs to the family of AMP-binding enzymes described by pfam00501.
Statistics
?
PSSM-Id: 274022
View PSSM: TIGR02188
Aligned: 26 rows
Threshold Bit Score: 1041.44
Threshold Setting Gi: 499180333
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2P2F_A        18 LINPEQYETKYKQSINDPDTFWGEQGKi-LDWITPYQKVKNTSFAPgnvSIKWYEDGTLNLAANCLDRHLQE-NGDRTAI 95  Salmonella ente...
Q82SI5        26 LSGREAYETLRQEAEHDYTGFWAKLAQqyIAWHKPFTRVLNDANPP---FYKWFDDGELNISWNCLDRHLAT-QADKTAI 101 Nitrosomonas eu...
Q8XY11        26 IAGMDAYRTLCAEAERDYEGFWARLAHehLLWHKPFSKVLDESRAP---FYTWFEDGELNASYNCLERNLENgNADKVAV 102 Ralstonia solan...
Q9CMW1        25 ISGLETYQALWEFADKDYLTYWSDLARelITWKKPFMHIFDDSEAP---FYKWFSDGTLNVSYNCLDRHLPD-KADKTAL 100 Pasteurella mul...
Q8DKH2        28 IHSLEAYNALYEKAKADPAAFWGELAQqeLEWFQPWEQVLDWQ-PP---NAKWFVNGKINITYNCLDRHLKTwRKNKAAL 103 Thermosynechoco...
Q8KBY0        36 ISSMEQYEKLYADAAADPDKYWG-DLAeqFHWFKKWDSVLEWN-AP---YAKWFNGGTTNIAYNCLDVHVGSwRKNKAAI 110 Chlorobium tepi...
Q9X928        23 AANANVTAEAYEQAKADRLGFWAEQARr-LTWAKEPTETLDWSNPP---FAKWFKDGTLNVAYNCVDRHVEAgNGDRVAI 98  Streptomyces co...
O69635        19 AEHANARAELYREAEEDRLAFWAKQANr-LSWTTPFTEVLDWSGAP---FAKWFVGGELNVAYNCVDRHVEAgHGDRVAI 94  Mycobacterium t...
O93730        27 YTPIDAYFKFHRQTVENLESFWESVAKe-LEWFKPWDKVLDASNPP---FYKWFVGGRLNLSYLAVDRHVKTwRKNKLAI 102 Pyrobaculum aer...
WP_009989839  22 LVSITTYKEIHSQTVKDYKQFWASVASe-IDWFKPWEKTLDDSNPP---FYKWFVGGELNASYLTVDRHVKSwRKNKVAI 97  Sulfolobus
2P2F_A        96 IWEGD---DTSQ---SKHISYRELHRDVCRFANTLLD-LGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSP 168 Salmonella ente...
Q82SI5       102 IFESD----AGe---VNHCSYRELHRQVCHFANGLKs-LGIRQGDRVVIYMPMRIEAVVAMQACARIGAIHSVVFGGFSA 173 Nitrosomonas eu...
Q8XY11       103 IFEAD----DGs---VARITYRELHARVCRFANGLKa-LGIRKGDRVVIYMPMSIEGVVAMQACARIGATHSVVFGGFSA 174 Ralstonia solan...
Q9CMW1       101 IFESD----FGq---VQLYTYAKLHNRVCRFANALRe-LGIKKGDRVIIYLPMLVEAVIAMQACARIGAVHSVVFGGFSA 172 Pasteurella mul...
Q8DKH2       104 IWEGE----PGd---SRTLTYAQLHREVCQFANVLKQ-LGVKKGDRVGIYMPMIPEAAIAMLACARIGAPHSVVFGGFSA 175 Thermosynechoco...
Q8KBY0       111 IWEGE----EGn---ERILTYGELHRQVSKFANVLKI-AGIKPGDKVAIYMGMVPELVIAVLACARVGAVHNVIFAGFAA 182 Chlorobium tepi...
Q9X928        99 HFEGEs---Gd----SRALTYAQLKDEVSKAANALLE-LGVQKGDRVAIYMPMIPETAIAMLACARIGAAHSVVFGGFSS 170 Streptomyces co...
O69635        95 HWEGEp--vGd----RRTLTYSDLLAEVSKAANALTD-LGLVAGDRVAIYLPLIPEAVIAMLACARLGIMHSVVFGGFTA 167 Mycobacterium t...
O93730       103 EWEGEpvdENGYptdRRKLTYYDLYREVNRVAYMLKQnFGVKKGDKITLYLPMVPELPITMLAAWRIGAITSVVFSGFSA 182 Pyrobaculum aer...
WP_009989839  98 IWEGEpvdEKGNpkeVRKLTYYDLYREVNRVAYLLKEkYGLKKGDAIAIYLPMIPELPIFMLAAARIGVVFTVVFSGFSA 177 Sulfolobus
2P2F_A       169 EAVAGRIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNvtSVEHVIVLKRTGSDiD-WQeGRDLWWRDLIEK--AS 245 Salmonella ente...
Q82SI5       174 KSVYERIIDAGASAVITADEQIRGGRYHPLKATVDEALAMGDtaTVHSVIVFRHTGTG-ItWQpERDHWWHDLIAg--QP 250 Nitrosomonas eu...
Q8XY11       175 KSLQERIVDVGAVAVITADEQMRGGKALPLKAIADEALAMEGseAVRHVIVYRRTGAG-VnWVeGRDRAMDEVEAg--QP 251 Ralstonia solan...
Q9CMW1       173 SALRDRIEDAEAKLVITANAGLRGGKIIPLKETVDEALEMGc-kTIENVIVFHRVNID-TpWKkGRDLWWNELTAn--QP 248 Pasteurella mul...
Q8DKH2       176 EALRDRLIDAQAKLVVTADGGWRKDAIVPLKDQVDKALAHQGvpSVENVLVVQRTQQP-VtMVpGRDHWWHDLQKg--VS 252 Thermosynechoco...
Q8KBY0       183 HAITERVNDSRAKIVICADGTRRRGSTINLKNIVDEAIINTp--SVKNVIVLKVTGEE-IhMHdGMDHWWHDLMGl--AV 257 Chlorobium tepi...
Q9X928       171 DALATRIQDADARVVITADGGYRRGKPSALKPAVDEAVERAG--IVEHVLVVRRTGQD-VaWDdSRDKWWHETVDg--QS 245 Streptomyces co...
O69635       168 AALQARIVDAQAKLLITADGQFRRGKPSPLKAAADEALAAIPdcSVEHVLVVRRTGIE-MaWSeGRDLWWHHVVGs--AS 244 Mycobacterium t...
O93730       183 DALAERINDSQSRIVITADGFWRRGRVVRLKEVVDAALEKATg--VESVIVLPRLGLKdVpMTeGRDYWWNKLMQGipPN 260 Pyrobaculum aer...
WP_009989839 178 DALASRINDAEAKLLITADGGWRRGKVVDLKGIVDKALEKTPt--IKDVIVVRRIGNK-VnMVeGRDKYFDEVIKDipQN 254 Sulfolobus
2P2F_A       246 PEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYH-PGDIYWCTADVGWVTGHSYLLYGPLACG 324 Salmonella ente...
Q82SI5       251 DECEPAWINAEHPLFTLYTSGSTGKPKGVQHSSAGYLLGAVTSMQWVFDYH-ADDVFWCTADVGWVTGHSYVAYGPLAIG 329 Nitrosomonas eu...
Q8XY11       252 DTCEVTPVGAEHPLFILYTSGSTGKPKGVQHSTGGYLLWALLTMQWTFDLK-PDDVFWCTADIGWVTGHTYIAYGPLAAG 330 Ralstonia solan...
Q9CMW1       249 AFCEPEWMNAEDPLFILYTSGSTGKPKGIVHSTGGYLLGALNSFRNVFDNK-PNDIFWCTADVGWITGHSYVCYGPLANG 327 Pasteurella mul...
Q8DKH2       253 ADCPAEPMDSEDLLFILYTSGSTGKPKGVVHTTAGYNLYTHITTQWVFDLQ-DTDVYWCTADVGWITGHSYIVYGPLSNG 331 Thermosynechoco...
Q8KBY0       258 DECEPAQVDSEHPLFLLYTSGSTGKPKGILHTTAGYMVHAASSFKYVFDIK-DEDIYFCTADIGWITGHTYIIYGPLLNG 336 Chlorobium tepi...
Q9X928       246 AEHTPEAFDAEHPLFILYTSGTTGKPKGILHTSGGYLTQTAYTHWAVFDLKpETDVFWCTADVGWVTGHSYIVYGPLANG 325 Streptomyces co...
O69635       245 PAHTPEPFDSEHPLFLLYTSGTTGKPKGIMHTSGGYLTQCCYTMRTIFDVKpDSDVFWCTADIGWVTGHTYGVYGPLCNG 324 Mycobacterium t...
O93730       261 AYIEPEPVESEHPSFILYTSGTTGKPKGIVHDTGGWAVHVYATMKWVFDIR-DDDIFWCTADIGWVTGHSYVVLGPLLMG 339 Pyrobaculum aer...
WP_009989839 255 VYVEPERMKSEDPLYILYTSGTTGKPKGIVHDIGGYMTLLHATMKWVFDIR-DDDIYWCTADIGWVTGHSYIVFGPLMEG 333 Sulfolobus
2P2F_A       325 ATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEG----DKAIEGTDRSSLRILGSVGEPINPEAWEWYWK 400 Salmonella ente...
Q82SI5       330 ATQVIFEGTPTHPHAGRFWEIIQKHRITTFYTAPTAIRSLIKLG----SDLPAKYDLSSLRLLGSVGEPINPEAWMWYYT 405 Nitrosomonas eu...
Q8XY11       331 ATQVVFEGVPTYPNAGRFWDMIQKHRVNTFYTAPTAIRSLIKAAeadeTSHPKRYDLSSLRLLGTVGEPINPEAWMWYHT 410 Ralstonia solan...
Q9CMW1       328 ATQVIFEGVPTYPDPGRIWRMIQRHKINVFYTSPTLIRSLTRLG----DHIPNKYDLSSLRLLGSVGEPINPSAWMWFYE 403 Pasteurella mul...
Q8DKH2       332 ATTLMYEGAPRPSNPGCFWDVIEKYGVTIFYTAPTAIRAFIKMG----EHLPRARDLSSLRLLGTVGEPINPEAWMWYYR 407 Thermosynechoco...
Q8KBY0       337 ATVFMYEGAPNYPQWDRFWDIINRHKITILYTAPTAIRAFIRAG----NEWVTKHDLSSLRLLGTVGEPINPEAWMWYHK 412 Chlorobium tepi...
Q9X928       326 ATQVMYEGTPDTPHQGRFWEIVQKYGVTILYTAPTAIRTFMKWG----DDIPAKFDLSSLRVLGSVGEPINPEAWIWYRK 401 Streptomyces co...
O69635       325 VTEVLYEGTPDTPDRHRHFQIIEKYGVTIYYTAPTLIRMFMKWG----REIPDSHDLSSLRLLGSVGEPINPEAWRWYRD 400 Mycobacterium t...
O93730       340 ATEVIYEGAPDYPQPDRWWSIIERYGVTIFYTSPTAIRMFMRYG----EEWPRKHDLSTLRIIHSVGEPINPEAWRWAYR 415 Pyrobaculum aer...
WP_009989839 334 ATEIMYEGALDYPQPDRWVSIIERYGITILYTSPTAIRSFMKYG----DNWVKAHITSTVRLMHSVGEPINPEAWEWLWK 409 Sulfolobus
2P2F_A       401 KIGKEKCPVVDTWWQTETGGFMITPLPG--AIELKAGSATRPFFGVQPALVDNEGHPQEgAtEGn-------LVITDSWP 471 Salmonella ente...
Q82SI5       406 VVGQSRCPVVDTWWQTETGCHMIAPAPGa--ISTKPGSCTLPLPGIDAAVVDETGHPVE-QgKGg------fLVIKRPFP 476 Nitrosomonas eu...
Q8XY11       411 NIGGGRCPIVDTFWQTETGGHMISPLPGa--TPLVPGSCTLPLPGIMAAIVDETGQDLP-DgQGg------iLVVKRPWP 481 Ralstonia solan...
Q9CMW1       404 VVGKSRCPIVDTWWQTETGSIMLAPIPGv--TATKPGSCTLPLPGIMAEVLDENGQKCA-VeQGg------aLAIKRPFP 474 Pasteurella mul...
Q8DKH2       408 VIGGERCPIVDTWWQTETGGHMITSLPGa--LPMKPGSASKPFPGILADVVDLEGNPVG-VnEGg------yLVIRHPWP 478 Thermosynechoco...
Q8KBY0       413 YVGQEKCPIVDTWWQTETGGIMISPMPGa--TPTKPGTATRPLPGIMVDVVRKDGTPCN-AnEGg------yLVVKRPWP 483 Chlorobium tepi...
Q9X928       402 NIGADATPVVDTWWQTETGAMMITPLPGv--THAKPGSAQRPLPGISATVVDDEANEVP-NgGGg------yLVLTEPWP 472 Streptomyces co...
O69635       401 VIGGGRTPLVDTWWQTETGSAMISPLPGi--AAAKPGSAMTPLPGISAKIVDDHGDPLP-PhTEgaqhvtgyLVLDQPWP 477 Mycobacterium t...
O93730       416 VLGNEKVAFGSTWWMTETGGIVISHAPGlyLVPMKPGTNGPPLPGFEVDVVDENGNPAP-PgVKg------yLVIKKPWP 488 Pyrobaculum aer...
WP_009989839 410 LVGREEVPFGSTWWMTETGGILISHLPGlyLVPMKPGTNGPPILGIEPDVVNEDGKQVN-LeERg------yLVIKNPWP 482 Sulfolobus
2P2F_A       472 GQARTLFGDHErFEQTYFSTFKN-----MYFSGDGARRDED-GYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEA 545 Salmonella ente...
Q82SI5       477 SMLRTLWNDPErFRKTYFP-TDIag-grYYLAGDSAHRDQD-GYFWIMGRVDDVLNVSGHRLGTMEIESALVAHPLVAEA 553 Nitrosomonas eu...
Q8XY11       482 AMIRTIWGDPErFRKSYFP-AELgg--kLYLAGDGSVRDKEtGYFTIMGRIDDVLNVSGHRMGTMEIESALVANPLVAEA 558 Ralstonia solan...
Q9CMW1       475 SMLRTIWNDPErYKSTYFP-AEYgg--kYYIAGDNAHRDKD-GYFWILGRTDDVLNVSGHRLGTMEIESALVASPKVAEA 550 Pasteurella mul...
Q8DKH2       479 GMMRTVYGDPDrFRRTYWEHIPPrdgqyFYFAGDGARRDED-GYFWVMGRVDDVINVSGHRLGTMEIESALVSHPAVAEA 557 Thermosynechoco...
Q8KBY0       484 SMLRTIYGDNErYEKTYWSEFPg-----MYFTGDGARKDDD-GYIWIMGRVDDVVNVSGHRLGTSEVESALVSHEAVAEA 557 Chlorobium tepi...
Q9X928       473 SMLRTIWGDDQrFIDTYWSRFEGk-----YFAGDGAKKDDD-GDIWLLGRVDDVMLVSGHNISTTEVESALVSHPSVAEA 546 Streptomyces co...
O69635       478 SMLRGIWGDPArYWHSYWSKFSDk---gYYFAGDGARIDPD-GAIWVLGRIDDVMNVSGHRISTAEVESALVAHSGVAEA 553 Mycobacterium t...
O93730       489 GMLHGIWGDPErYIKTYWSRFPG-----MFYAGDYAIKDKD-GYIWVLGRADEVIKVAGHRLGTYELESALISHPAVAES 562 Pyrobaculum aer...
WP_009989839 483 GMPLTIYKDPErYVKVYWSRFPG-----MFYVGDYAVKDKD-GYFWILGRADEVIKVAGHRLGTYELESALIEHPAVAEA 556 Sulfolobus
2P2F_A       546 AVVGIPHAIKGQAIYAYVTLNHGEEpSPe---LYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAgD 622 Salmonella ente...
Q82SI5       554 AVVGKPHEIKGEVVVAFVTLREKLPdDQraaeIAATLREWVASEIGAIARPEEIRFGENLPKTRSGKIMRRLLRALARgE 633 Nitrosomonas eu...
Q8XY11       559 AVVGRPDDMTGEAICAFVVLKRTRPnGDearqIATDLRNWVGKEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSIAKgE 638 Ralstonia solan...
Q9CMW1       551 AVVGKPDEIKGEAIVAFVVLNDFRPeGEearqLAEELKAWVSNEIGKIARPEDIRFADNLPKTRSGKIMRRLLRSIAKnE 630 Pasteurella mul...
Q8DKH2       558 AVVGKPDEVKGEEIVAFVILEGSATpSDa---LQQELKQHVVNEIGALARPAEIRFTDALPKTRSGKIMRRLLRSLAAgQ 634 Thermosynechoco...
Q8KBY0       558 AVVSRPDEIKGNALVAFVTLKDGYEgDAk---LRDSLGKHVAKEIGAIAKPDEIRWAKGLPKTRSGKIMRRLLRELATsN 634 Chlorobium tepi...
Q9X928       547 AVVGATDETTGQAIVAFVILRGTTAeSEd---LVAELRNHVGATLGPIAKPKRILPVSELPKTRSGKIMRRLLRDVAEnR 623 Streptomyces co...
O69635       554 AVVGVTDETTTQAICAFVVLRANYApHDr---TAEELRTEVARVISPIARPRDVHVVPELPKTRSGKIMRRLLRDVAEnR 630 Mycobacterium t...
O93730       563 AVVGVPDAIKGEVPIAFVVLKQGVApSDe---LRKELREHVRRTIGPIAEPAQIFFVTKLPKTRSGKIMRRLLKAVATgA 639 Pyrobaculum aer...
WP_009989839 557 AVIGVPDPVKGEVPYAFVILRQGYTpNTq---LSQEILKTVRDKVGPIATIDKIFFVGKLPKTRSGKIMRRVVRAVATrA 633 Sulfolobus
2P2F_A       623 tSNLgDTSTLADPGVVEKLLEE 644 Salmonella enterica subsp. enterica serovar Typhimurium
Q82SI5       634 -TITqDVSTLENPVILEQLSQT 654 Nitrosomonas europaea ATCC 19718
Q8XY11       639 -DITqDTSTLENPAILEQLKEA 659 Ralstonia solanacearum GMI1000
Q9CMW1       631 -MITqDISTLENPQIIGQLQQQ 651 Pasteurella multocida subsp. multocida str. Pm70
Q8DKH2       635 -EVVgDTSTLEDRSVLDRLRQG 655 Thermosynechococcus elongatus BP-1
Q8KBY0       635 -EIKgDVTTLEDLGVIENLREQ 655 Chlorobium tepidum TLS
Q9X928       624 -QVG-DVTTLADSTVMDLIQTK 643 Streptomyces coelicolor A3(2)
O69635       631 -ELG-DTSTLLDPTVFDAIRAA 650 Mycobacterium tuberculosis
O93730       640 -PLG-DVTTLEDETSVEEAKRA 659 Pyrobaculum aerophilum str. IM2
WP_009989839 634 -EVG-DITTLEDEASVEEIKKA 653 Sulfolobus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap