Conserved Protein Domain Family
Myco_arth_vir_N

?
TIGR02184: Myco_arth_vir_N 
Mycoplasma virulence family signal region
This model represents the N-terminal region, including a probable signal sequence or signal anchor which in most instances has four consecutive Lys residues before the hydrophobic stretch, of a family of large, virulence-associated proteins in Mycoplasma arthritidis and smaller proteins in Mycoplasma capricolum.
Statistics
?
PSSM-Id: 213689
Aligned: 5 rows
Threshold Bit Score: 31.7103
Created: 8-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_005683423    1 MIKAKKKKIFIITAAVVSPIVVTQVAAIPFYVK 33   Mycoplasma alligatoris
WP_015545324    1 MYFLKKKKNKILTLVLVTSLATSLSFGSVIYYS 33   Mycoplasma mycoides
WP_012498441    1 MSNSKKKKIAIATLAIATTLLAAGTISGVIYSK 33   Mycoplasma arthritidis
WP_012498132    1 MNRSKKKKNTIAALTISTALLVSSTISGILYIK 33   Mycoplasma arthritidis
WP_005683208    1 MIKAKKKKIIIVSSIAGGALIIPHAIAVPIYLK 33   Mycoplasma alligatoris
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap