Conserved Protein Domain Family
GRXA

?
TIGR02183: GRXA 
Glutaredoxin, GrxA family
Glutaredoxins are thioltransferases (disulfide reductases) which utilize glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system. Glutaredoxins utilize the CXXC motif common to thioredoxins and are involved in multiple cellular processes including protection from redox stress, reduction of critical enzymes such as ribonucleotide reductase and the generation of reduced sulfur for iron sulfur cluster formation. Glutaredoxins are capable of reduction of mixed disulfides of glutathione as well as the formation of glutathione mixed disulfides. This model includes the E. coli glyutaredoxin GrxA which appears to have primary responsibility for the reduction of ribonucleotide reductase.
Statistics
?
PSSM-Id: 131238
View PSSM: TIGR02183
Aligned: 4 rows
Threshold Bit Score: 142.659
Threshold Setting Gi: 33147757
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P45242    2 FVVIFGRPGCPYCVRAKNLAEKLKGEVADFDYRYVDIHAEGITKEDLSKSVGKPVETVPQIFIDEKPIGGCTDFEALMKE 81  Haemophilus influenz...
Q9Z5Z3    2 FTVIFGRPGCPYCVRAKELAEKLSKERDDFNYRYIDIHAEGITKADLEKTVGKPVETVPQIFVDQKHIGGCTDFEAWAKE 81  Salmonella typhimurium
AAN55773  2 YVVIFGRPGCPYCVRAVQLSEQLVEKRDDFKFRYVDIHAEGISKADLEKTVGKPVETVPQIFVDEKHVGGCTDFEQYVRD 81  Shewanella oneidensi...
AAP95279  2 LVEIYGCLSCLYCVRAKQLAEKMAIELADFEFKFIDMIAEGISKQDLAVRVGKAVDTVPQIFLDDQAVGGCTEFQQLVKQ 81  Haemophilus ducreyi ...
P45242   82 QFGIVA 87  Haemophilus influenzae Rd KW20
Q9Z5Z3   82 NLNLFA 87  Salmonella typhimurium
AAN55773 82 NNLLG- 86  Shewanella oneidensis MR-1
AAP95279 82 KFDIEL 87  Haemophilus ducreyi 35000HP
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap