Conserved Protein Domain Family
yeiP

?
TIGR02178: yeiP 
elongation factor P-like protein YeiP
This model represents the family of Escherichia coli protein YeiP, a close homolog of elongation factor P (TIGR00038) and probably itself a translation factor. Member of this family are found only in some Gammaproteobacteria, including E. coli and Vibrio cholerae. [Protein synthesis, Translation factors]
Statistics
?
PSSM-Id: 131233
View PSSM: TIGR02178
Aligned: 3 rows
Threshold Bit Score: 326.069
Threshold Setting Gi: 31563071
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P33028   3 RANEIKKGMVLNYNGKLLLVKDIDIQSPTARGAATLYKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYVDFSYVDGNEY 82  Escherichia coli
Q9KSP7   3 KASELKKGFAIISNGKTLLIKDIEVTTPGGRGGSKIYKLRCTDLNTGARVDERYKSDDVLDTVEMNKRPISFSYIDGDEY 82  Vibrio cholerae O1 bi...
Q87C43   2 KASEMKKGSIVEYSNGTYQIRDIQRSSPQGRGGNVRFRFVMYSVPGGSKLEASFDADEMLTAVELLRREASFSYKDGEAF 81  Xylella fastidiosa Te...
P33028  83 VFMDKEDYTPYTFTKDQIEEELLFMPEGgMPDMQVLTWDGQLLALELPQTVDLEIVETAPGIKGASASARNKPATLSTGL 162 Escherichia coli
Q9KSP7  83 VFMNNDDYTPYNFKKDEIEDELLFITEE-IQGMSVVLVDGEAVAIELPSSVEMVIEETDPSIKGASASSRTKPARMPTGL 161 Vibrio cholerae O1 bi...
Q87C43  82 VFLDEEDYTLYTLDAEAIGDNAGYISEG-LSGCYVQLIDASPVALQLPQHVVLEVVDTPPELKGGTATKRPKPAKLITGI 160 Xylella fastidiosa Te...
P33028 163 VIQVPEYLSPGEKIRIHIEERRYMGRA 189 Escherichia coli
Q9KSP7 162 VVQVPEYIATGDRIVINTAERKFMNRA 188 Vibrio cholerae O1 biovar El Tor str. N16961
Q87C43 161 EVMVPEYITTGERILVNTTTGAFGGRA 187 Xylella fastidiosa Temecula1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap