1B0P


Conserved Protein Domain Family
pyruv_ox_red

?
TIGR02176: pyruv_ox_red 
Click on image for an interactive view with Cn3D
pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric
This model represents a single chain form of pyruvate:ferredoxin (or flavodoxin) oxidoreductase. This enzyme may transfer electrons to nitrogenase in nitrogen-fixing species. Portions of this protein are homologous to gamma subunit of the four subunit pyruvate:ferredoxin (flavodoxin) oxidoreductase.
Statistics
?
PSSM-Id: 131231
View PSSM: TIGR02176
Aligned: 7 rows
Threshold Bit Score: 2154.88
Threshold Setting Gi: 21647632
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1B0P_A          4 MMTTDGNTATAHVAYAMSEVAAIYPITPSSTMGEEADDWAAQGRKNIFGQTLTIREMQSEAGAAGAVHGALAAGALTTTF 83   Desulfovibrio...
AAQ65740        7 FLTCDGNQAAAHIAYMFSEVAAIYPITPSSTMAEYVDDWAAAGRKNIFGETVRVQEMQSEAGAAGAVHGSLQGGALTTTF 86   Porphyromonas...
CAA70873        5 MMTTDGNTATAHVAYAMSEVAAIYPITPSSTMGEEADDWAAQGRKNIFGQTLTIREMQSEAGAAGAVHGALAAGALTTTF 84   Desulfovibrio...
AAO81890        4 MKTMDGNAAAAYISYAFTELAAIYPITPSSTMAELVDQWSAEGKKNIFGQPVKVVEMQSEAGAAGVVHGSLKTGALTTTY 83   Enterococcus ...
tigr:CT1628     5 FKTMEGNEALAHVAYRTNEVISIYPITPASPMGEYSDAWAAVDVKNIWGTVPLVNEMQSEAGAAAAVHGALQTGALTTTF 84   Chlorobium te...
WP_010965794    5 LKTMDGNEAAAYASYAFTDVAAIYPITPSTPMAELVDNWSSHGRKNIFGQPVKIVEMQSEAGAAGTVHGSLIAGALTTTY 84   Clostridium a...
AAS11159        7 LVMIDGNTAAGHVAHALSEVIAIYPITPSSPMGEVADEYSARGRENIWGTVPDVVELQSEGGAAGAVHGALTTGALSSTF 86   Treponema den...
1B0P_A         84 TASQGLLLMIPNMYKISGELLPGVFHVTARAIAAHALSIFGDHQDIYAARQTGFAMLASSSVQEAHDMALVAHLAAIESN 163  Desulfovibrio...
AAQ65740       87 TASQGLLLMIPNMYKIAGELLPCVFHVSARTIASHALSIFGDHQDVMAARQTGFAQLCTGSVQEVMDLAGVAHLATLRTR 166  Porphyromonas...
CAA70873       85 TASQGLLLMIPNMYKISGELLPGVFHVTARAIAAHALSIFGDHQDIYAARQTGFAMLASSSVQEAHDMALVAHLAAIESN 164  Desulfovibrio...
AAO81890       84 TASQGLLLMIPNMYKIAGELLPSVFHVASRALTTNALNIFGDQGDVMAARQTGFAMLSESSVQEVMDLAPVAHLASIEAS 163  Enterococcus ...
tigr:CT1628    85 TASQGLLLMIPNMYKIAGELTPCVIHVSARSLAAQALSIFCDHGDVMSVRGTGFALLASCSVQEVMDMALISQAATLESR 164  Chlorobium te...
WP_010965794   85 TASQGLLLMIPNMYKMAGELLPCVFHVSARAIATHALSIFGDHQDVMAARQTGFVLLASSNVQEVMDLAMVSHLAAIKAR 164  Clostridium a...
AAS11159       87 TASQGLLLMIPNMYKIAGELTSTVFHIAARAVACSALSIFGDHQDVMACRQTGWAMLASNSVQEVMDLAIISHAATLEAR 166  Treponema den...
1B0P_A        164 VPFMHFFDGFRTSHEIQKIEVLDYADMASLVNQKALAEFRAKSMNPEHPHVRGTAQNPDIYFQGREAANPYYLKVPGIVA 243  Desulfovibrio...
AAQ65740      167 IPFIHFFDGFRTSHEIQKIEALDNEDLARFIDWDDVKRFRKQALNPESPVTRGTAQNGDIYFQNREACNRFYDAVPEAVQ 246  Porphyromonas...
CAA70873      165 VPFMHFFDGFRTSHEIQKIEVLDYADMASLVNQKALAEFRAKSMNPEHPHVRGTAQNPDIYFQGREAANPYYLKVPGIVA 244  Desulfovibrio...
AAO81890      164 VPFMNFFDGFRTSHEIQKVAVLDYEELAPLVNQEKLAEFHRRSMNPNHPSVSGMNQNPDIHFQQRETINPYYEKLPGIVQ 243  Enterococcus ...
tigr:CT1628   165 VPFLHFFDGFRTSHEISKIEVLSDEQIRSMINDELVFAHRMRRMSPDAPIIRGTSQNPDVYFQARESVNKYYEACPSITQ 244  Chlorobium te...
WP_010965794  165 VPFMHFFDGFRTSHEYQKIEMIDYNDVAPLVDYESIKAFRSRALNPEHPTVRGTAQNPDIYFQGREASNNFYTAVPDIVE 244  Clostridium a...
AAS11159      167 VPFLHFFDGFRTSHEIQKIEEVSYDIMRQMVSDELVRAHRKRGLTPEKPELRGTAQNPDIYFQGREAVNKYYLATPEIVQ 246  Treponema den...
1B0P_A        244 EYMQKVASLTGRSYKLFDYVGAPDAERVIVSMGSSCETIEEVINHLAAKGEKIGLIKVRLYRPFVSEAFFAALPASAKVI 323  Desulfovibrio...
AAQ65740      247 YYMDQLATVTGRHYHLFDYYGDPEAEHVIIAMGSVTEAIREVIDFLRAKGEKVGLLSVHLYRPFSAKHFLAAMPKTVKRI 326  Porphyromonas...
CAA70873      245 EYMQKVASLTGRSYKLFDYVGAPDAERVIVSMGSSCETIEEVINHLAAKGEKIGLIKVRLYRPFVSEAFFAALPASAKVI 324  Desulfovibrio...
AAO81890      244 KYMTEINRLRGTNYDLVTYYGAEDAEEVIVTMGSVAQTIEQTVDYLQQQGRKVGFLNVHLYRPFPIETFLEKVPQSVKAI 323  Enterococcus ...
tigr:CT1628   245 KAMDQFAKLTGRSYKLYQYYGAPDADRIIIMMGSGAETALETVEYLNNHGEKVGLVKVRLFRPFDVATFIASLPSSVKSI 324  Chlorobium te...
WP_010965794  245 SYMREIEKITGRVYHPFDYYGDPEAEDIIIAMGSVCDTVEETVDYLRSKGQKVGLLKVHLYRPFSTDYFFKYLPKTIKRI 324  Clostridium a...
AAS11159      247 KQMDKYAKLTGRQYHLYDYYGAKDAEQIIILMGSGADTVEETVDELNSKGGKYGVIKVRLYRPFSAEHFVKAIPTTVKGI 326  Treponema den...
1B0P_A        324 TVLDRTKEPGAPGDPLYLDVCSAFVERg-------EAMPKILAGRYGLGSKEFSPAMVKSVYDNMSG---AkKNHFTVGI 393  Desulfovibrio...
AAQ65740      327 AVLDRTKEPGATGEPLYLDVRDCYYGM--------EDAPLIVGGRYGLSSKDTTPAQMKAVFDNLKLn--VpKDHFTVGI 396  Porphyromonas...
CAA70873      325 TVLDRTKEPGAPGDPLYLDVCSAFVERg-------EAMPKILAGRYGLGSKEFSPAMVKSVYDNMSG---AkKNHFTVGI 394  Desulfovibrio...
AAO81890      324 AVLDRTKEPGAGGEPLLLDVQSAMYEA--------DIRPTIIGGRYGLGSKDVLPNQIVAVFDELMKersAmKKRFTIGI 395  Enterococcus ...
tigr:CT1628   325 AVLDRVKEPGSAGEPLYLDVVNAVAESyqe--gkcASMPSVLGGRYGLSSKEFTPAMVKAIFDNMNAe--SpKNHFTVGI 400  Chlorobium te...
WP_010965794  325 AVLDRTKEPGSAGEPLYLDVVNAFYNH--------PNKPVIVGGRFGLGSKDTRPSQILSVFDNLRAq--SpKNRFTIGI 394  Clostridium a...
AAS11159      327 AVLDRCKEAGSLGEPLYEDVRTAIGEMqaakkcpfTHYPVIIGGRYGLGSKEFTPAMVKGVFDNLEGe--K-KTNFSVGI 403  Treponema den...
1B0P_A        394 EDDVTGTSLPVDnAFADTTPKGTIQCQFWGLGADGTVGANKQAIKIIGDNTDLFAQGYFSYDSKKSGGITISHLRFGEKP 473  Desulfovibrio...
AAQ65740      397 VDDVTFTSLPLG-EDLIFDNPSLVEAKFYGLGADGTVGANKNSVKIIGDNTNKYCQAYFAYDSKKSGGFTCSHLRFGDTP 475  Porphyromonas...
CAA70873      395 EDDVTGTSLPVDnAFADTTPKGTIQCQFWGLGADGTVGANKQAIKIIGDNTDLFAQGYFSYDSKKSGGITISHLRFGEKP 474  Desulfovibrio...
AAO81890      396 DDDLTYTSLEVG-KPLDLTNPKTYQAKFWGFGSDGTVGANKSAIKIIGDHTDKYAQGFFYYDSKKSGGLTVSHLRFGETP 474  Enterococcus ...
tigr:CT1628   401 DDDVTKKSLAYD-ETFSIEPDSVFRALFYGLGSDGTVGANKNSIKIIGENTDNYAQGFFVYDSKKAGSITTSHLRFGPEQ 479  Chlorobium te...
WP_010965794  395 VDDVSNTSLPEG-EIIDTTPQGTIRCKFYGLGSDGTVGANKSAIKIIGDNTDMYCQAYFSYDSKKSGGSTVSHLRFGNKP 473  Clostridium a...
AAS11159      404 EDDVTHTSIKYD-PNFKLEDKDMHQAMFFGLGSDGTVGANKNSIKIIGEATDNKAQAYFSYDSKKSGGFTISHLRFGKHA 482  Treponema den...
1B0P_A        474 IQSTYLVNRADYVACHNPAYVGIYDILEGIKDGGTFVLNSPWsS-LEDMDKHLPSGIKRTIANKKLKFYNIDAVKIATDV 552  Desulfovibrio...
AAQ65740      476 IRSTYLVVTPDFVACHVPAYLRMYDVLKGLKKKGTFLLNSIW-A-PEDIEQHLPNKVKRYLAKNNIRFYTINATAIAQQI 553  Porphyromonas...
CAA70873      475 IQSTYLVNRADYVACHNPAYVGIYDILEGIKDGGTFVLNSPW-SsLEDMDKHLPSGIKRTIANKKLKFYNIDAVKIATDV 553  Desulfovibrio...
AAO81890      475 IRSTYLIEHSDFVACHTAAYLHTYDLVKGLKKGGTFLLNTIW-N-DEQLARFLPNQLKRYLAENEIQFYTINAVKLASEV 552  Enterococcus ...
tigr:CT1628   480 IRSTYLITEAQFVGCHHWVFLEMIDVAKNLKQGGTLLINSAY-A-PDVVWSKLPRPVQQHLIDKQAKLYTIDAYKVAHES 557  Chlorobium te...
WP_010965794  474 IKSPYLVYEADYIACHNKSFIYNINVLKGLKKNGIFVLNCPF-K-DNELDEHLPNAMKKYIADNNIQFYTIDAVSIAQEV 551  Clostridium a...
AAS11159      483 IRKPYLITNADFVACHKFSYLETYDMLHSLKKGGTFLLNAPY-G-KNEIWDNMPVEVQKQIIEKEAKFYVIDAIKIAEKA 560  Treponema den...
1B0P_A        553 GLGGRINMIMQTAFFKLAGVLPFEKAVDLLKKSIHKAYGKKGEKIVKMNTDAVDQAVtSLQEFKYPDSWKDAPAETKA-E 631  Desulfovibrio...
AAQ65740      554 GLGNRTNTILQSAFFKIANVIPYDLAVEQMKKFIVKSYGKKGEDVVNKNFAAVDRGG-DVVEITVKPEWADLPDDPVVrH 632  Porphyromonas...
CAA70873      554 GLGGRINMIMQTAFFKLAGVLPFEKAVDLLKKSIHKAYGKKGEKIVKMNTDAVDQAVtSLQEFKYPDSWKDAPAETKA-E 632  Desulfovibrio...
AAO81890      553 GLGGRINTAMETAFFKLAEIMPFEQVLPILKEEALKSYGHKSMKVVEKNIQAIDKTVeLLHQVPVPAEWRTLEVQPRKrS 632  Enterococcus ...
tigr:CT1628   558 GMGQRINTIMQACFFAISGVLPREEAIEKIKDAIRHTYGKKGDEVVQQNIKAVDNTLaNLHEVKIGAVADSTKELRSPiV 637  Chlorobium te...
WP_010965794  552 GLGSRINMIMQSAFFKLANIIPVDKAVQYLKDSIEYTYGKKGATIVDANKKAVDAGVnAAHKVTVPEAWKNAESNYQP-L 630  Clostridium a...
AAS11159      561 GMGNRINVVMQTAFFKIFGILPEAEAVDLIKKFIEKSYGKKGPEIVQKNITTIDMALeGVEKVDYPKTATSKLKMHPAiA 640  Treponema den...
1B0P_A        632 PMTNEFFKNVVKPILTQQGDKLPVSAFEA----DGRFPLGTSQFEKRGVAINVPQWVPENCIQCNQCAFVCPHSAILPVL 707  Desulfovibrio...
AAQ65740      633 EGDTDFVHNVVRPINAQAGDDLPVSAFLGr--eDGTWDSGTAASEKRGVAAFVPVWEADNCVQCNQCAYVCPHATIRPFV 710  Porphyromonas...
CAA70873      633 PMTNEFFKNVVKPILTQQGDKLPVSAFEA----DGRFPLGTSQFEKRGVAINVPQWVPENCIQCNQCAFVCPHSAILPVL 708  Desulfovibrio...
AAO81890      633 ENVSDFVHEIVEPINRQEGNALSVATLAKngmtDGRMPLGTAAVEKRGVALEVPEWISDRCTMCNECAFVCPHAAIRPFL 712  Enterococcus ...
tigr:CT1628   638 GDAPEFVCNVLAKIIAGEGDSIPVSKLPA----DGTYPLGTTKFEKRNLAQEIPVWAPELCIECGKCSMVCPHAAIRIKV 713  Chlorobium te...
WP_010965794  631 KGLPDFVQRIERPMARHEGDELPVSAFKGm--eDGVFPLGITAYEKRGIAVNVPEWQIDKCIQCNQCAYVCPHSVIRACL 708  Clostridium a...
AAS11159      641 GDAPEFVKNVLGKVAIQKGDDIKVSEMPE----DGTFPTATTQYEKRAIAEHIPIWKSDICIQCGQCVMVCPHACIRMKA 716  Treponema den...
1B0P_A        708 AKEEELVGApaNFTALEAKGKELKGYKFRIQINTLDCMGCGNCADICPPK----E--KALVMQPLDTQRDaQVPNLEYAA 781  Desulfovibrio...
AAQ65740      711 LTKEEEEKT--GVKVLKAVGKQFPDMGFRIQVNVMDCLGCSNCVDVCPGN----KngKALTMQPIEEQYE-EQKNWDKMI 783  Porphyromonas...
CAA70873      709 AKEEELVGApaNFTALEAKGKELKGYKFRIQINTLDCMGCGNCADICPPKe------KALVMQPLDTQRDaQVPNLEYAA 782  Desulfovibrio...
AAO81890      713 ADEEEMTEApeGFIVRDLRG--ADGLKYRIQVSVKDCTGCGLCVEACPAKg------KALVMKPYEEEKE-QAMNWAFAM 783  Enterococcus ...
tigr:CT1628   714 YEPKHLENApaTFKSLDAKAKNWEGMRYTVQIAPEDCTGCQLCVNACPARdkqvEgrKALNMHEQAPLREtESACWSFFI 793  Chlorobium te...
WP_010965794  709 LDDEEKENApeRFVTKKPVGKGLEHLHYKIQISPLDCTGCGNCADICPAPg------KALIMKPAAEQIEeQSENFEYAL 782  Clostridium a...
AAS11159      717 YDSSLLAKApqGFKSCDYKGKEFEGAKFTIQVSSEDCTGCGLCVQQCPAKskenPeiKAINMENFVEHRKqEVANWNFFF 796  Treponema den...
1B0P_A        782 R-IPVKS-EVLPRDS-LKGSQFQEPLMEFSGACSGCGETPYVRVITQLFGERMFIANATGCSSIWGASAPSMPYKTNRLG 858  Desulfovibrio...
AAQ65740      784 SgVTGKA-HLVDIAAnVKNSQFATPLFEFSGACSGCGETPYVKLITQLYGDRQTVANATGCSSIYSASAPSTPYTKNERG 862  Porphyromonas...
CAA70873      783 R-IPVKS-EVLPRDS-LKGSQFQEPLMEFSGACSGCGETPYVRVITQLFGERMFIANATGCSSIWGASAPSMPYKTNRLG 859  Desulfovibrio...
AAO81890      784 T-LRQKE-NPAKPNT-VLGSQFNKPLLEFSGACSGCGETPYVKLLTQMFGDRMLIANATGCSSIWGAAAGVTPYTTNEQG 860  Enterococcus ...
tigr:CT1628   794 N-LPEFDrNKINQRL-IKEQQLQQPLFEFSGACSGCGETPYVKLMTQLFGDRLVIGNATGCSSIYGGNLPTTPYAANPQG 871  Chlorobium te...
WP_010965794  783 K-VKPKE-GIMDIHT-VKGSQFSRPLLEFNGACPGCGETPYIKLLTQLYGDRMMIANATGCSSIWGASAPSIAYTTNNFG 859  Clostridium a...
AAS11159      797 NdIPEPDvKKLNLSV-PKGIGMKRPLFEFSGACAGCGETPYVKLLSQLFGDRAVIANATGCSSIYGGNLPTTPYAKRCDG 875  Treponema den...
1B0P_A        859 QGPAWGNSLFEDAAEYGFGMNMSMFARRTHLADLAAKALESD-ASGDVKEALQGWLAGKNDPIKSKEYGDKLKKLLAGQK 937  Desulfovibrio...
AAQ65740      863 EGPAWANSLFEDNAEFGLGMHLAYKKMRRRLVNLAEEAQQSPcCSDELKALLREWVEKRQDAVASKVLADKIKPLVAACD 942  Porphyromonas...
CAA70873      860 QGPAWGNSLFEDAAEYGFGMNMSMFARRTHLADLAAKALESDaS-GDVKEALQGWLAGKNDPIKSKEYGDKLKKLLAGQK 938  Desulfovibrio...
AAO81890      861 QGPAWSNSLLEDNAEFGYGMLLATQARRERLASKMTKAFSv--ASDSLRLLMEDWIAHLSESEGTQQRAAKLRAALLEEK 938  Enterococcus ...
tigr:CT1628   872 LGPTWSNSLFEDTAEFALGFRISIDKQQQFAKELVKKLAGDi-GENLATAILNATQNSEPEIFEQRERVAVLKDKLQQMK 950  Chlorobium te...
WP_010965794  860 KGPSWGNSLFEDNAEYGYGMFLGVKQMRERLAELMEEAINSNiN-SDLKDAFSLWLDGFDDGDKSKEASNKILRIMENED 938  Clostridium a...
AAS11159      876 RGPAWSNSLFEDAAEFGYGMRLTSDKLAVYAREVAAKAKAKGiAAGVIDKILNNAQEDDAAIEDQRAFVAELKKELAGSK 955  Treponema den...
1B0P_A        938 ---DGLLGQIAAMSDLYTKKSVWIFGGDGWAYDIGYGGLDHVLASGEDVNVFVMDTEVYSNTGGQSSKATPTGAVAKFAA 1014 Desulfovibrio...
AAQ65740      943 ---CDICKRIGRVDSFFIKRAQWIIGGDGWAYDIGFGGLDHVIASGMNVNILVLDTEVYSNTGGQSSKSTPIGAIAKFAA 1019 Porphyromonas...
CAA70873      939 ---DGLLGQIAAMSDLYTKKSVWIFGGDGWAYDIGYGGLDHVLASGEDVNVFVMDTEVYSNTGGQSSKATPTGAVAKFAA 1015 Desulfovibrio...
AAO81890      939 t-nQPLLEAIYDDQDLFVKPSQWMIGGDGWAYDIGYGGIDHVLASGADVNMLVLDNEVYSNTGGQTSKATPASAIAKFAA 1017 Enterococcus ...
tigr:CT1628   951 ---SDDAKNLLAVADMLVKKSVWAVGGDGWAYDIGYGGLDHVTASGKNVNMLVLDTEVYSNTGGQASKATPKAAIAKFAA 1027 Chlorobium te...
WP_010965794  939 fkgDKLLSEIYDKKDYLVKKSHWLIGGDGWAYDIGFGGVDQVLALGDDVNIFVMDTEIYSNTGGQSSKSTPTGAIAKFAS 1018 Clostridium a...
AAS11159      956 ---DELAKELDSLTDHFIKRSVWILGGDGWAYDIGYGGLDHVLASGKNINVLVMDTEVYSNTGGQMSKATPIGAVAKFAA 1032 Treponema den...
1B0P_A       1015 AGKRTGKKDLARMVMTYGYVYVATVSMGYSKQQFLKVLKEAESFPGPSLVIAYATCINQGLRKGMGksQDVMNTAVKSGY 1094 Desulfovibrio...
AAQ65740     1020 AGKRIRKKDLGMIAATYGYVYVAQVSIGANPAQTLKAIREAEAYDGPSIVIAYSPCISHGIKSGMGktQAEGKRAVECGY 1099 Porphyromonas...
CAA70873     1016 AGKRTGKKDLARMVMTYGYVYVATVSMGYSKQQFLKVLKEAESFPGPSLVIAYATCINQGLRKGMGksQDVMNTAVKSGY 1095 Desulfovibrio...
AAO81890     1018 SGKYASKKDLGMMAMTYENVYVAQIASGANQMQTIKAFEEAEKFPGPSIIIAYTPCITHGLAGGMSqtLKEAKDAVHSGY 1097 Enterococcus ...
tigr:CT1628  1028 AGRIATKKDLGLISMSYGNAYVASVALGARDEQTLRAFIEAEAYDGPSIIIAYSHCIAHGFDLSMG--LEHQKAAVDSGH 1105 Chlorobium te...
WP_010965794 1019 AGKKTRKKDLGLMAMTYGNVYVTQIAMGANMTHTIKAITEAEAYKGPSLVIAYAPCISHGIKTGMGtsIAQEKKAVEAGY 1098 Clostridium a...
AAS11159     1033 SGKEVSKKDLGMMAMSYGYVYVAHISMGANMSQVIKAFREAESYDGPSIIIAYSHCINHGINMTKG--MTNQKEAVSCGL 1110 Treponema den...
1B0P_A       1095 WPLFRYDPRLAAQGKNPFQLDSKAP-DGSVEEFLMAQNRFAVLDRSFPEDAKRLRAQVAHELDVRFKELEHMAA 1167 Desulfovibrio afric...
AAQ65740     1100 WHLWRYNPELEKEGKNPFQMDSKEPnWSEFKNFLKGEVRYASLYKEFPEDAEQLFDAAFENAQWRYRNYMRMSA 1173 Porphyromonas gingi...
CAA70873     1096 WPLFRYDPRLAAQGKNPFQLDSKAP-DGSVEEFLMAQNRFAVLDRSFPEDAKRLRAQVAHELDVRFKELEHMAA 1168 Desulfovibrio afric...
AAO81890     1098 WSLYRYNPLLREKGKEPMILDFKKPdFSLMKEFMRQQVRFASLESSQPDTAELLFNKTINDAKRRFYNYARLAG 1171 Enterococcus faecal...
tigr:CT1628  1106 WLLYRYNPDRLKEGLNPLQLDSKKP-KMPVAEFLNMENRFRILKKTHPDLAKKYFEAIQHEVNARWAHYEHLAN 1178 Chlorobium tepidum TLS
WP_010965794 1099 WHLYRYNPLLKEQGKNPFILDSKEP-TESYTDFINGELRYSSLKTIFPDKVEDAFNKSAENAKERYSLYKKLSE 1171 Clostridium acetobu...
AAS11159     1111 WPLYRYDPRLVEQGKNPFQLDSKEP-DFNLADFMYKEVRFKTLKNADPARAQMLLDKAVAKAKRQWQEYKYLAD 1183 Treponema denticola...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap