Conserved Protein Domain Family
Fb_sc_TIGR02172

?
TIGR02172: Fb_sc_TIGR02172 
Fibrobacter succinogenes paralogous family TIGR02172
This model describes a paralogous family of five proteins, likely to be enzymes, in the rumen bacterium Fibrobacter succinogenes S85. Members show homology to proteins described by pfam01636, a phosphotransferase enzyme family associated with resistance to aminoglycoside antibiotics.
Statistics
?
PSSM-Id: 162743
View PSSM: TIGR02172
Aligned: 5 rows
Threshold Bit Score: 359.47
Threshold Setting Gi: 506212535
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_014545630   6 IDISTWTQVGEGGNGKTYVHPGHPdFLLKVNNPpRC--DEATVKQERDAAQHVFDLGIPTPRMFDMVRVGD--GYGQLVE 81  Fibrobacter suc...
WP_014545629   8 INLDDYAATGEGATAISYTHKTRD-TIAKLYHP-GF--EADCAKKDFLTSCTAFALGVPTPKPIRLVTDGE--RFGAEYE 81  Fibrobacter suc...
WP_015731876  10 IDLNDYIQTGEGGTALAYTHKNGK-SLAKLYNP-DF--DANTIKNEFWASRTAFELGISTPEPFRLITDGK--RFGGEYE 83  Fibrobacter suc...
WP_014544967  28 IDLSQWTMFSNRHNSENYNSPDGK-WMLKLGFP-GFcsTKEELLREQDICRKVVSLGIPTPHVGDIVEQDG--RLGLIYE 103 Fibrobacter suc...
WP_015732310   6 INLNDWELQGEGAFGESYFSKTDSsIMLKLMKP-EG--RKEDIIAEFENSRKIASVGFKTPAAIELVEESQsgRLGIIYE 82  Fibrobacter suc...
WP_014545630  82 IIKGKKSLSRICSDDPSRISEMAKLLASLGLQLHALPCNTDFFPSRKDLALKGIDASDFVADDDREKMRAFVQSIEDEKT 161 Fibrobacter suc...
WP_014545629  82 LIRNKRSFSRIISEEPGRLQELSLIFAEMAKKLHSTKADTSKLVSTKEKFRRFYLEKAVVPDFYKQKALAFINTVPNTPT 161 Fibrobacter suc...
WP_015731876  84 LIEGKRSFSRIISQESERLEEISLEFARMARELHATKADTSRLKSYKQMITQFYSEKDFVPKDYRNRILKFLDKVPDTET 163 Fibrobacter suc...
WP_014544967 104 RIVGKRSISKCVGENPEHLEEYIKVFAEHCKKLHSTSCIPGTFQDAEEKYSRLIEESKMFPENVKEFARNLIKETPKVSR 183 Fibrobacter suc...
WP_015732310  83 KVQEKISFTRMIHDNPSDLPRIAKIHAEEAKKFHGINCDPTQFLCYKETIRKAIP-KLFTFKKYKDILKAAIELVPDSHG 161 Fibrobacter suc...
WP_014545630 162 CLHGDFQMGNLIISGDGk-PYWIDLGWFSHGSPMFDIGHFFMTCQVYSQFPaAQEIFHMSQEQLKNFWNAFAEAY 235 Fibrobacter succinog...
WP_014545629 162 CLHGDLQISNVITDGKR--TLWIDMGDFGYGDPGWDLGMLWSMTNRMDEQK-ADLVFHMNKEKLLAHWNIFFPAY 233 Fibrobacter succinog...
WP_015731876 164 CLHGDLQIGNAITDGKR--TFWIDLGGFGYGAPEWDLALMWNLAHMPDADK-LDFLFHLPSETMKTHWNIFFSAY 235 Fibrobacter succinog...
WP_014544967 184 CVHGDMQTGNLIVNDNG--AYFIDLGEFACGNPLFDLGCYFYFCHYLPDDY-LLAAHYMNAAMMHKCWDVFAKYY 255 Fibrobacter succinog...
WP_015732310 162 CLQYDFQPGNIVHSNKTgeNYWIDMGDFGYGHYLFDIALLYMFTNILCTKKsVQQIFHMTEQQLRAYWVEFTAAY 236 Fibrobacter succinog...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap