Conserved Protein Domain Family

TIGR02164: torA 
Click on image for an interactive view with Cn3D
trimethylamine-N-oxide reductase TorA
This very narrowly defined family represents TorA, part of a family of related molybdoenzymes that include biotin sulfoxide reductases, dimethyl sulfoxide reductases, and at least two different subfamilies of trimethylamine-N-oxide reductases. A single enzyme from the larger family may have more than one activity. TorA typically is located in the periplasm, has a Tat (twin-arginine translocation)-dependent signal sequence, and is encoded in a torCAD operon.
PSSM-Id: 131219
Aligned: 5 rows
Threshold Bit Score: 1581.8
Threshold Setting Gi: 2506867
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
AAK03877     778 NTMSLDIGSSSLAQAVSANTCLVNIEKFVGQAPAVTGFHGPHEVAL 823 Pasteurella multocida subsp. multocida str. Pm70
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap