1TMO


Conserved Protein Domain Family
torA

?
TIGR02164: torA 
Click on image for an interactive view with Cn3D
trimethylamine-N-oxide reductase TorA
This very narrowly defined family represents TorA, part of a family of related molybdoenzymes that include biotin sulfoxide reductases, dimethyl sulfoxide reductases, and at least two different subfamilies of trimethylamine-N-oxide reductases. A single enzyme from the larger family may have more than one activity. TorA typically is located in the periplasm, has a Tat (twin-arginine translocation)-dependent signal sequence, and is encoded in a torCAD operon.
Statistics
?
PSSM-Id: 131219
View PSSM: TIGR02164
Aligned: 5 rows
Threshold Bit Score: 1581.8
Threshold Setting Gi: 2506867
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1TMO_A         1 MNRRDFLKGIAsSSFVVLGGSSVLTPLNALAKAGINE----DEWLTTGSHFGAFKMKRKNGVIAEVKPFDLDKYPTDMIN 76  Shewanella mass...
AAK03877       3 QSRRQFLKNMS-AMAATFAMPNFLIAQNAFAQSAENV----SEWKITGSHWGAIRAKVQNGKVVDVKPFEYDQYPTEMIK 77  Pasteurella mul...
P33225         9 ASRRRFLAQLGgLTVAGMLGPSLLTPRRATAAQAATDavisKEGILTGSHWGAIRATVKDGRFVAAKPFELDKYPSKMIA 88  Escherichia col...
WP_001018812   3 ITRRSFLKGVAtTSAASIIGPSLLTSVSAQAAETTG------TWKVSGSHWGAFRAHIYGGKVQELKALELDTHPTEMLN 76  Vibrio cholerae
O87948         1 MNRRDFLKGIAsSSFVVLGGSSVLTPLNALAKAGINE----DEWLTTGSHFGAFKMKRKNGVIAEVKPFDLDKYPTDMIN 76  Shewanella mass...
1TMO_A        77 GIRGMVYNPSRVRYPMVRLDFLLKGHKSNTHQRGDFRFVRVTWDKALTLFKHSLDEVQTQYGPSGLHAGQTGWRATGQLH 156 Shewanella mass...
AAK03877      78 GIKDLIYSEARIRYPMVRLDWLKKRHNSNTAQRGDNRFVRVTWDEALDLFYEELERIQQNYGPWALHTGNVGWRSTGQFH 157 Pasteurella mul...
P33225        89 GLPDHVHNAARIRYPMVRVDWLRKRHLSDTSQRGDNRFVRVSWDEALDMFYEELERVQKTHGPSALLT-ASGWQSTGMFH 167 Escherichia col...
WP_001018812  77 GIQGILYSPSRVRYPMVRLDWLKK-HKYSAETRGNNRFIRVTWDEAIDLFYRELERVQKQYGPWALHAGQTGWNQTGAFH 155 Vibrio cholerae
O87948        77 GIRGMVYNPSRVRYPMVRLDFLLKGHKSNTHQRGDFRFVRVTWDKALTLFKHSLDEVQTQYGPSGLHAGQTGWRATGQLH 156 Shewanella mass...
1TMO_A       157 SSTSHMQRAVGMHGNYVKKIGDYSTGAGQTILPYVLGSTEVYAQGTSWPLILEHSDTIVLWSNDPYKNLQVGWNAETHES 236 Shewanella mass...
AAK03877     158 SCGNHMIRAVGMHGNSVSTSGDYSTGAGQVILPYVLGSTEVYSQGTSWEIILKESENIIFWASDPVKNLQVGWNCETHEA 237 Pasteurella mul...
P33225       168 NASGMLAKAIALHGNSVGTGGDYSTGAAQVILPRVVGSMEVYEQQTSWPLVLQNSKTIVLWGSDLLKNQQANWWCPDHDV 247 Escherichia col...
WP_001018812 156 NCTAMMQRAVGMHGNYITKVGDYSTGAGQTIMPYVLGSTEVYAQGTSWSEILDNSDNIILWANDPVKNLQVGWNCETHQS 235 Vibrio cholerae
O87948       157 SSTSHMQRAVGMHGNYVKKIGDYSTGAGQTILPYVLGSTEVYAQGTSWPLILEHSDTIVLWSNDPYKNLQVGWNAETHES 236 Shewanella mass...
1TMO_A       237 FAYLAQLKEKVKQGKIRVISIDPVVTKTQAYLGCE---QLYVNPQTDVTLMLAIAHEMISKKLYDDKFIQGYSLGFEEFV 313 Shewanella mass...
AAK03877     238 YKYLEQLKAKVAAKDVNVICVDPVKSKTQNYLGCD---FQYINPQTDVAFMLALAHTLYVENLYDKKFIEMYTVGFEKFL 314 Pasteurella mul...
P33225       248 YEYYAQLKAKVAAGEIEVISIDPVVTSTHEYLGREhvkHIAVNPQTDVPLQLALAHTLYSENLYDKNFLANYCVGFEQFL 327 Escherichia col...
WP_001018812 236 FGYLDQLKEKVAKGEINVVSVDPVKNKTQRFLQND---HLYINPQTDVAFMLALAHVLYTENLYDKKFIETYCLGFEEFI 312 Vibrio cholerae
O87948       237 FAYLAQLKEKVKQGKIRVISIDPVVTKTQAYLGCE---QLYVNPQTDVTLMLAIAHEMISKKLYDDKFIQGYSLGFEEFV 313 Shewanella mass...
1TMO_A       314 PYVMG-TKDGVAKTPEWAAPICGVEAHVIRDLAKTLVKGRTQFMMGWCIQRQQHGEQPYWMAAVLATMIGQIGLPGGGIS 392 Shewanella mass...
AAK03877     315 PYLLGeSEDKVVKDAEWAAKICAIQAEDIRQFARMLAGKRTQLIFGWAIQRQQHGEQPYWMGTVLAAMLGQIGLAGGGIS 394 Pasteurella mul...
P33225       328 PYLLG-EKDGQPKDAAWAEKLTGIDAETIRGLARQMAANRTQIIAGWCVQRMQHGEQWAWMIVVLAAMLGQIGLPGGGFG 406 Escherichia col...
WP_001018812 313 PYVLGkSKDKVEKTPEWAATICGVKPDAIRDFARMLVNGRTQLLFGWCIQRQEHGEQPYWMGAVLAAMIGQIGLPGGGIS 392 Vibrio cholerae
O87948       314 PYVMG-TKDGVAKTPEWAAPICGVEAHVIRDLAKTLVKGRTQFMMGWCIQRQQHGEQPYWMAAVLATMIGQIGLPGGGIS 392 Shewanella mass...
1TMO_A       393 YGHHYSSIGVPSSGAAAPGAFPRNLDENQKPLFDSSDFKGASSTIPVARWIDAILEPGKTIDANGSKVVYPDIKMMIFSG 472 Shewanella mass...
AAK03877     395 YAHHYSSIGIPSSGAAMPGAFPLNLDEGQKPKYDNKNYNGYSAVIPCARITDSLLQPGETIDHNGQKITYAPYKMAIFTG 474 Pasteurella mul...
P33225       407 FGWHYNGAGTPGRKGVILSGFSG--STSIPPVHDNSDYKGYSSTIPIARFIDAILEPGKVINWNGKSVKLPPLKMCIFAG 484 Escherichia col...
WP_001018812 393 YGHHYSGIGVPSTGFAGPGGFPRNLDQGAKPKWDNNDFNGYSRTIPVARWIDAILEPGKKINHNGNTVTLPGFKMMVISG 472 Vibrio cholerae
O87948       393 YGHHYSSIGVPSSGAAAPGAFPRNLDENQKPLFDSSDFKGASSTIPVARWIDAILEPGKTIDANGSKVVYPDIKMMIFSG 472 Shewanella mass...
1TMO_A       473 NNPWNHHQDRNRMKQAFHKLECVVTVDVNWTATCRFSDIVLPACTTYERNDIDVYGAYANRGILAMQKMVEPLFDSLSDF 552 Shewanella mass...
AAK03877     475 CNHWHRHSERNKMKQAFQRLETIVSINYSWTATCRFSDIVLPACTPFERNDIDAYGSYSNRGVIAMQKLVDPLYDSRSDF 554 Pasteurella mul...
P33225       485 TNPFHRHQQINRIIEGLRKLETVIAIDNQWTSTCRFADIVLPATTQFERNDLDQYGNHSNRGIIAMKQVVPPQFEARNDF 564 Escherichia col...
WP_001018812 473 CNPWHHHQDRNKMKRAFQKLETVVTIDFSWTATCRFSDIVLPACTQWERNDIDSYGSYSGKGLIAMHRLVDPLFQSRTDF 552 Vibrio cholerae
O87948       473 NNPWNHHQDRNRMKQAFHKLECVVTVDVNWTATCRFSDIVLPACTTYERNDIDVYGAYANRGILAMQKMVEPLFDSLSDF 552 Shewanella mass...
1TMO_A       553 EIFTRFAAVLGKEKEYTRNMGEMEWLETLYNECKAANAGK-FEMPDFATFWKQG-YVHFGDGEVWTRHADFRNDPEINPL 630 Shewanella mass...
AAK03877     555 EIFKDLCRRFGKEKEYCRNMDEMEWVKHLYEACRQENQGK-FDMPPFAEFWQKG-YVLFPEGEPWVRHADFREDPELHAL 632 Pasteurella mul...
P33225       565 DIFRELCRRFNREEAFTEGLDEMGWLKRIWQEGVQQGKGRgVHLPAFDDFWNNKeYVEFDHPQMFVRHQAFREDPDLEPL 644 Escherichia col...
WP_001018812 553 EIMTELTRRFGREKEYTRGMDEMEWVRSLYDECKKANEGK-FAMPEFEEFWEKG-FLDFGTGTPWVRHADFRKDPEINAL 630 Vibrio cholerae
O87948       553 EIFTRFAAVLGKEKEYTRNMGEMEWLETLYNECKAANAGK-FEMPDFATFWKQG-YVHFGDGEVWTRHADFRNDPEINPL 630 Shewanella mass...
1TMO_A       631 GTPSGLIEIFSRKIDQFGYDDCKGHPTWMEKTERSHGGPGSDKHPIWLQSCHPDKRLHSQMCESREYRETYAVNGREPVY 710 Shewanella mass...
AAK03877     633 GTPSGFIEIFSNKIASYGYADCKGHPMWFEKAERSHGGPKSDKYPFWLQSAHPDKRLHSQLCESKALRETYAIQDREPLF 712 Pasteurella mul...
P33225       645 GTPSGLIEIYSKTIADMNYDDCQGHPMWFEKIERSHGGPGSQKYPLHLQSVHPDFRLHSQLCESETLRQQYTVAGKEPVF 724 Escherichia col...
WP_001018812 631 GTPSGFIEITSRKIGRYGYEHCQEHPMWFEKTERSHGGPGSDKHPFWLQSCHPDKRLHSQMCEAEAFRATYAVQGREPVY 710 Vibrio cholerae
O87948       631 GTPSGLIEIFSRKIDQFGYDDCKGHPTWMEKTERSHGGPGSDKHPIWLQSCHPDKRLHSQMCESREYRETYAVNGREPVY 710 Shewanella mass...
1TMO_A       711 ISPVDAKARGIKDGDIVRVFNDRGQLLAGAVVSDNFPKGIVRIHEGAWYGPVgkdgsteGg-------AEVGALCSYGDP 783 Shewanella mass...
AAK03877     713 INPEDAKRLGIVHGDLVRVYNDRGQAIVGAHVSDNFPQGVLRLQEGAWYSPL-------D--------EKVGSIDTYGDP 777 Pasteurella mul...
P33225       725 INPQDASARGIRNGDVVRVFNARGQVLAGAVVSDRYAPGVARIHEGAWYDPD-------Kg-------GEPGALCKYGNP 790 Escherichia col...
WP_001018812 711 INPLDAKAKGIKDGDLVRVFNDRGQLLAGAVLSDSYPRGVIRIEEGAWYGPL-------T--------EKVGAICTYGDP 775 Vibrio cholerae
O87948       711 ISPVDAKARGIKDGDIVRVFNDRGQLLAGAVVSDNFPKGIVRIHEGAWYGPV-------GkdgsteggAEVGALCSYGDP 783 Shewanella mass...
1TMO_A       784 NTLTLDIGTSKLAQACSAYTCLVEFEKYQGKVPKVSSFDGPIEVEI 829 Shewanella massilia
AAK03877     778 NTMSLDIGSSSLAQAVSANTCLVNIEKFVGQAPAVTGFHGPHEVAL 823 Pasteurella multocida subsp. multocida str. Pm70
P33225       791 NVLTIDIGTSQLAQATSAHTTLVEIEKYNGTVEQVTAFNGPVEMVA 836 Escherichia coli K-12
WP_001018812 776 NTLTLDLGTSELAQATSANTCIVDFEKFRGEVPPVTSFGGPIEVI- 820 Vibrio cholerae
O87948       784 NTLTLDIGTSKLAQACSAYTCLVEFEKYQGKVPKVSSFDGPIEVEI 829 Shewanella massilia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap