Conserved Protein Domain Family
napC_nirT

?
TIGR02161: napC_nirT 
periplasmic nitrate (or nitrite) reductase c-type cytochrome, NapC/NirT family
Nearly every member of this subfamily is NapC, a predicted membrane-anchored four-heme c-type cytochrome that forms one component of the periplasmic nitrate reductase along with NapA, NapB, NapD, NapE, and NapF subunits. A single known exception at this time is NirT, which is instead a component of a nitrite reductase. This family excludes TorC subunits of trimethylamine N-oxide (TMAO) reductases.
Statistics
?
PSSM-Id: 131216
View PSSM: TIGR02161
Aligned: 10 rows
Threshold Bit Score: 347.143
Threshold Setting Gi: 37201398
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q53178         6 FLRRFWSIATSPSsFLSVGFLTLGGFVGGVLFWGGFNTALEATNTEAFCTSCHEMQSNVFEELTRTVHYTNRSGVRAGCP 85  Rhodobacter sph...
Q56352        14 RVTWFWRVISRPSsFLSIGFLTLGGFICGVIFWGGFNTALEITNTEKFCTSCHEMRDNVYQELMPTVHFSNRSGVRASCP 93  Paracoccus pant...
BAB59026      11 VLREWWATLRRPSgRWSLGLLLVVGFVGGVIFWGGFNTVLELTNTEAFCLSCHEMEQNVYREYRGSIHDSNRSGVRATCP 90  Magnetospirillu...
P24038        10 QKGGILALLRRPStRYSLGGILIVGIVAGIVFWGGFNTALEATNTETFCISCHEMGDNVYPEYKETIHYANRTGVRATCP 89  Pseudomonas stu...
BAC97220       3 LLKAFWKRLSTPS-KAAAGILLFMGFAGGLLFWGAFNTGMEATNSEEFCSGCHAP---IVAEIQETIHYSNRSGVRAICS 78  Vibrio vulnific...
P33932        10 LIKRLWKWWRTPS-RLALGTLLLIGFVGGIVFWGGFNTGMEKANTEEFCISCHEMRNTVYQEYMDSVHYNNRSGVRATCP 88  Escherichia coli
AAK03682       4 LIKRFWKWFRSPS-RIAVGTLITLAFIAGIVSWVGFNYGLEQTNTEEFCVSCHSN--DVYPEYLHTAHYLNRSGVKATCP 80  Pasteurella mul...
P44655         8 ILKRFWQWFRKPS-RMAIGTIIILSAIGGILSWVGFNYGLEKTNTEQFCASCHMQ--DAYPEYLHSVHYQTRTGVGASCP 84  Haemophilus inf...
AAP95088       1 MFKAGVNWLRRPS-KMALGLLILIISACTLIAWSGFNVVLEKTNTEQFCSDCHMN--DVVPEYRASAHYSNRSGVKAVCA 77  Haemophilus duc...
WP_031300736   7 WLAGYWRVLRRPSvHFSLGFLTLGGFIAGIVFWGGFNTALEATNTETFCISCHEMRDNVFVELKDTIHYSNRSGVRATCP 86  Pseudomonas aer...
Q53178        86 DCHVPHEWTDKIARKMQASKEVWGHLFGTIDTRRKFLDNRLRLAEHEWARLKANDSLECRNCHSEVAMDFTRQTDRAAQI 165 Rhodobacter sph...
Q56352        94 DCHVPHEWTDKIARKMQASKEVWGKIFGTISTREKFLEKRLELAKHEWARLKANDSLECRNCHAAVAMDFTKQTRRAPQI 173 Paracoccus pant...
BAB59026      91 DCHVPRPWIYKIQRKIQASNEVWHKLLGSIDTREKFEAKRIELAKHEWERMKSTDSRECRNCHNFGAFDLTRQQARARNR 170 Magnetospirillu...
P24038        90 DCHVPRDWTHKMVRKVEASKELWGKIVGTIDTAEKFEAKRLTLARREWARMRASDSRECRNCHSLESMSSDMQKQRARKQ 169 Pseudomonas stu...
BAC97220      79 DCHVPHEWTDKIVRKVQASKELFAHFIGTIDTPEKFQERRAHLAEREWARLKKNDSLECRNCHEFEYMDFSEQGARSAKQ 158 Vibrio vulnific...
P33932        89 DCHVPHEFVPKMIRKLKASKELYGKIFGVIDTPQKFEAHRLTMAQNEWRRMKDNNSQECRNCHNFEYMDTTAQKSVAAKM 168 Escherichia coli
AAK03682      81 DCHVPHEFIPKMIRKVQASREVYAHLMGYTDTIDKFNSRRLHMAEREWARLKANNSQECRNCHNFENMDFSQQKTVAEKM 160 Pasteurella mul...
P44655        85 DCHVPHEFGAKMKRKIIAAKEVYAHYTGKVDTLEKFNAHRLEMAQNEWARMKANDSKECRNCHNVDRMTFNDQRSVAARM 164 Haemophilus inf...
AAP95088      78 DCHVPHEFAPKMLRKLQASTEVYAHLTGKVDNKEKFEAHRLAMAEREWARMKANNSQECRNCHNFEDMDFTQQKTVAQQM 157 Haemophilus duc...
WP_031300736  87 DCHVPHKWTDKIARKMQASKEVWGKIFGTINTREKFLDHRRELAEHEWARLKANDSLECRNCHNFEFMDFTRQSVRARQM 166 Pseudomonas aer...
Q53178       166 HTQYLIQTEgyTCIDCHKGIAHELPDMR 193 Rhodobacter sphaeroides 2.4.1
Q56352       174 HERYLISGEk-TCIDCHKGIAHQLPDMT 200 Paracoccus pantotrophus
BAB59026     171 HSEAEQQGK--TCIDCHKGIAHQLPAGA 196 Magnetospirillum magnetotacticum
P24038       170 HEMAREDNL--TCIACHKGIAHHLPEGM 195 Pseudomonas stutzeri
BAC97220     159 HSTALASGEk-TCVDCHKGIAHKLPDMH 185 Vibrio vulnificus YJ016
P33932       169 HDQAVKDGQ--TCIDCHKGIAHKLPDMR 194 Escherichia coli
AAK03682     161 HALAIKEEK--TCIDCHKGIAHQLPDMS 186 Pasteurella multocida subsp. multocida str. Pm70
P44655       165 HQKMKTEGK--TCIDCHKGIAHQLPDMS 190 Haemophilus influenzae Rd KW20
AAP95088     158 HSRAETENK--TCIDCHKGIAHNLPHME 183 Haemophilus ducreyi 35000HP
WP_031300736 167 HSTALASGEa-TCIDCHKGIAHHLPDMT 193 Pseudomonas aeruginosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap