Conserved Protein Domain Family
PA_CoA_Oxy5

?
TIGR02160: PA_CoA_Oxy5 
phenylacetate-CoA oxygenase/reductase, PaaK subunit
Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131215
View PSSM: TIGR02160
Aligned: 4 rows
Threshold Bit Score: 591.412
Threshold Setting Gi: 490069492
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P76081         4 FHSLTVAKVESETRDAVTITFAVPQPLQEAYRFRPGQHLTLKASFDGEELRRCYSICRSYLPGEISVAVKAIEGGRFSRY 83  Escherichia col...
AAG28972       9 FHPLKVAEVRRETPEAVSLRFEIPAELAEDYRFEQGQHLNLKVMVNGEELRRSYSICSGVDDNELRVAIKKIGGGVFSTW 88  Azoarcus evansii
WP_006769650  13 FNALTVSEVRRLTDDAVEISFEVPEELQADYDYIPGQYVALRTQLDGAEVRRSYSICDIPRPGTIRVAVKKNLGGLFSTW 92  Corynebacterium...
WP_003971667  20 FHRLRVAAVERLCADAAAVSFEIPDELAGEFVFAPGQSLTLRREVDGRDERRSYSIC-APAGSAPRIGVRVVPGGLFSAW 98  Streptomyces
P76081        84 AREH-IRQGMTLEVMVPQGHFGYQPQAER------------QGRYLAIAAGSGITPMLAIIATTLQTEPESQFTLIYGNR 150 Escherichia col...
AAG28972      89 ANDGgIRVGDVLEVMTPEGRFHTPLDPAH------------AKHYVAFAAGSGITPILSLVKTTLAAEPHSRFTLVYSNR 156 Azoarcus evansii
WP_006769650  93 ANEE-LKAGDTLEVMNPQGGFTSKTHVTSlndaetiaqeagNNHLVAVAAGSGITPIMAIAQTVLAENPKATFEIVYANK 171 Corynebacterium...
WP_003971667  99 LVDE-VRPGDTVEVMAPTGLFTPDLSTP--------------GHHVLVAAGSGITPMVSIAESVLAADDRSTVTLFYGNR 163 Streptomyces
P76081       151 TSQSMMFRQALADLKDKYPQRLQLLCIFSQETLDSDLLHGRIDGEKLQSLGASLINFRLYDEAFICGPAAMMDDAETALK 230 Escherichia col...
AAG28972     157 RQASVMFAETLEDLKNRHMARFTLYNLFSREEQEVPLFNGRLDGERVRQFLDTLIPVDTIDEAFICGPGAMIDEVEAALQ 236 Azoarcus evansii
WP_006769650 172 GGADVMFAEEIGDLKDKYPQRFAVHHVLSREQRVNPLFSGRIDDEKLNLLLDQVLRTDEVKEWFLCGPFELVQLCRDELE 251 Corynebacterium...
WP_003971667 164 RTDTVMFADELADLKDLHPTRFHLAHVLSREPREAEVLSGRLDAGRLAALVGSLVDVERADHWWLCGPQGMVADAQQVLT 243 Streptomyces
P76081       231 ALGMPDKTIHLERFNT------PGT--RVKRSVN-VQSDGQKVTVRQDGRD-REIVLNADDESILDAALRQGADLPYACK 300 Escherichia col...
AAG28972     237 AAGLAHEHIHLERFGV------PAS--APEHHVEpGDATQAKVTVIADGLT-REMEFRAEDPSILDVALRAGMDLPYSCK 307 Azoarcus evansii
WP_006769650 252 GRGVDSANVRFELFTTgkpgdgPGQgnTGRPVIAdPEGDNITISFTLDGLSgTIESPSSARESVLNAALRARPDVPFACA 331 Corynebacterium...
WP_003971667 244 GLGVPAGRVHRELFYAdd---ePVR--EVRHEESgPEGPVSEVTITLDGRS-T-TSSLSRERSVLDGAQQTRPDLPFACK 316 Streptomyces
P76081       301 GGVCATCKCKVLRGKVAMETNYSLEPDELAAGYVLSCQALPLTSDVVVDFD 351 Escherichia coli K-12
AAG28972     308 VGVCCTCRAKLLEGKVRMDKNFTLEQPDVDAGYILTCQAHPLIDRVVISFD 358 Azoarcus evansii
WP_006769650 332 GGVCGTCRAKVIEGEYEMEENYALEPDEVEAGYVLTCQTRPKGDTLVVDYD 382 Corynebacterium efficiens
WP_003971667 317 GGVCGTCRALVTDGSVDMRRNYALETAEVDAGYVLTCQSYPVSEKLTVDYD 367 Streptomyces
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap