Conserved Protein Domain Family
PA_CoA_Oxy4

?
TIGR02159: PA_CoA_Oxy4 
phenylacetate-CoA oxygenase, PaaJ subunit
Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131214
View PSSM: TIGR02159
Aligned: 5 rows
Threshold Bit Score: 230.06
Threshold Setting Gi: 499342145
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P76080        22 IPDPEIPVLTITDLGMVRNVTQMGEGWVIG-FTPTYSGCPATEHLIGAIREAMTTNG-FTPVQVVLQLDPAWTTDWMTPD 99  Escherichia col...
AAG28971      14 VPDPEIPVISVTELGIVREVHARDGGLHIV-VTPTYSGCPATEVIAQSIRDALVAAG-AGEVDVETRLAPAWTTAWITEP 91  Azoarcus evansii
WP_010889009  25 VPDPEIPVVSIVDMGMVREVKVDGEGVSVT-FTPTFSGCPALHVIRQSIEDAVRGLG-VNDVEVKSTLTPPWTTDSILPD 102 Deinococcus rad...
WP_010896381  16 VDDPELPSVSVFDLGMVHSVDVEQGLVTVK-MIPTFIGCPALDMIKKDVKRAVEVLPwVEVCEVSFSMQELWSTAAITEE 94  Bacillus halodu...
WP_011031685  20 VPDPELPMLTLADLGVLRDVEVDGDGTVVAsLTPTYSGCPAMAEMRADVAARLRAAG-YPRVEIRTVLDPPWTSDWITES 98  Streptomyces co...
P76080       100 ARERLREYGISPPAGHSCHA------HLPPEVRCPRCASVHTTLISEFGSTACKALYRCDSCREPFDYFKCI 165 Escherichia coli K-12
AAG28971      92 AKEKLRAYGIAPPSGDAAVGgaqpirFVPRKLACPRCGSTDTTRLSQFGSTACKALYRCQSCLEPFEYFKPI 163 Azoarcus evansii
WP_010889009 103 ARERLREYGIAPPAPAEGSLi----sLEPEPTSCPRCGSFNVRMTASFGPTLCKRLYVCDACKEPFEGFKSV 170 Deinococcus radiodurans
WP_010896381  95 GKTCLKKHGIAPPPEHYVVG-------EEWSVQCPYCESAYTSIENIFGPTACRSILYCRACKNPFEAMKPI 159 Bacillus halodurans
WP_011031685  99 GRGKLAEHGIAPPGAAPRGPvslvlsPTRPAVPCPRCGSADTEETSRFAATSCKALWRCRACREPFEYVKEI 170 Streptomyces coelicolor
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap